(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE445

PENCW_13.PE445       Location/Qualifiers
FT   CDS             join(complement(1015448..1015655),
FT                   complement(1013929..1015412),complement(1012927..1013871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671906"
FT                   /orf_name="Pc16g04450"
FT                   /product="Pc16g04450 protein"
FT                   /protein_id="CAP93115.1"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="InterPro:IPR022092"
FT                   /db_xref="UniParc:UPI00018316E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R3"
FT                   /transl_table=1
FT                   /translation="MAQNSQTQKPKWGVGSFFQQAVAGVESRLDHILMDEEGNQSNSTA
FT                   KPTETQGGEAPPTKAPVPCMRPTTPVSRSSSTARRNDRLQERLARAMVKQNTSSLSSKS
FT                   PQSRVSSLPASPVPSNGARSSMDMDSSVASVNSAVEDPKAPQSNDDSNPAKLASPRISY
FT                   DSGVSPRVSTEISVTDSAPRTSVDVVQPSIDSAKASQETSDSQRDSVLNDLDSGDSPRV
FT                   SVESPSEVPEEGENPDIARLRAERKTAESQWQEEMHGYIERIDALQSKLKYLAKDAAES
FT                   AKNAAASATPGSTQKQLLEKDEKIALLLEEGQKLSKSEMDHRTVIKKLRQQLTEHTKSQ
FT                   AEMKRKTDKLERDLANSEARAKRAEAAEKRATESLSSQTKSTKDLEAVTNERNALSQTV
FT                   QDIKSQLSRAVSRAEAAETKANSDALELEKQRARELDEELCNLKIEHDISEERSKREIT
FT                   ELKEKIDQEKERARMLEAELKGEQSVLESKMESLRSRAEEASSGATGETQAKLLRQIET
FT                   LQTQYAAASENWHTLEGSLLSRLASVEKERDDAGRREIDLRKKIREMNHKLKKFEEELD
FT                   NAKEAEHDLSSRLEERMEELQKLQQKLEKAADDLASTQKDMAEQKKTCDTTWAQKLEEE
FT                   RAKWREQVNSPSQLRGVSPVASLRRSSTLDAMTPGQPECRPPSRRSSTMAFASPEIGTP
FT                   PRQNSYPASITQATLSPPHINTNPSLMAAPSITFEPDEYFEDSGTPATPSAYGGTQAHP
FT                   PRGINDIISESTVGAGPSVQLVERMSATVRRLESERAGSKDELARVTTQRDEARQQVVD
FT                   LMRELEEKQLSDSRVQELEAELEDLDQRYQTTLEMLGEKSEQVDELNADIADLKKIYRE
FT                   LVDSTMK"
     MAQNSQTQKP KWGVGSFFQQ AVAGVESRLD HILMDEEGNQ SNSTAKPTET QGGEAPPTKA        60
     PVPCMRPTTP VSRSSSTARR NDRLQERLAR AMVKQNTSSL SSKSPQSRVS SLPASPVPSN       120
     GARSSMDMDS SVASVNSAVE DPKAPQSNDD SNPAKLASPR ISYDSGVSPR VSTEISVTDS       180
     APRTSVDVVQ PSIDSAKASQ ETSDSQRDSV LNDLDSGDSP RVSVESPSEV PEEGENPDIA       240
     RLRAERKTAE SQWQEEMHGY IERIDALQSK LKYLAKDAAE SAKNAAASAT PGSTQKQLLE       300
     KDEKIALLLE EGQKLSKSEM DHRTVIKKLR QQLTEHTKSQ AEMKRKTDKL ERDLANSEAR       360
     AKRAEAAEKR ATESLSSQTK STKDLEAVTN ERNALSQTVQ DIKSQLSRAV SRAEAAETKA       420
     NSDALELEKQ RARELDEELC NLKIEHDISE ERSKREITEL KEKIDQEKER ARMLEAELKG       480
     EQSVLESKME SLRSRAEEAS SGATGETQAK LLRQIETLQT QYAAASENWH TLEGSLLSRL       540
     ASVEKERDDA GRREIDLRKK IREMNHKLKK FEEELDNAKE AEHDLSSRLE ERMEELQKLQ       600
     QKLEKAADDL ASTQKDMAEQ KKTCDTTWAQ KLEEERAKWR EQVNSPSQLR GVSPVASLRR       660
     SSTLDAMTPG QPECRPPSRR SSTMAFASPE IGTPPRQNSY PASITQATLS PPHINTNPSL       720
     MAAPSITFEP DEYFEDSGTP ATPSAYGGTQ AHPPRGINDI ISESTVGAGP SVQLVERMSA       780
     TVRRLESERA GSKDELARVT TQRDEARQQV VDLMRELEEK QLSDSRVQEL EAELEDLDQR       840
     YQTTLEMLGE KSEQVDELNA DIADLKKIYR ELVDSTMK                               878
//

If you have problems or comments...

PBIL Back to PBIL home page