(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE446

PENCW_13.PE446       Location/Qualifiers
FT   CDS             join(1016199..1016493,1016552..1017077,1017139..1017751)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948775"
FT                   /orf_name="Pc16g04460"
FT                   /product="Pc16g04460 protein"
FT                   /EC_number="3.6.3.6"
FT                   /function="binding"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="CAP93116.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018316E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R4"
FT                   /transl_table=1
FT                   /translation="MSLEPPTYLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIKAVDK
FT                   VRKDQRRQTIEGDLAAYTGLLAGGAQGKSVLDSASRRTDIVQYILVLASDLIQDVPSLA
FT                   SSLVSHPEPYKPFLPFLQHSTNAEDPIPLLTSTFLTALVSHSLVASSKPAPRDNEALPQ
FT                   LYTYLSTLTKNQDSGLQDIGVQGFSELLRTSRAREIFWAQRQETLAPLIDTLRAAAGAK
FT                   DNVGNASTLGSSSRSVEPGLAGGVGLQLLYRVLLVLWQLAFEGALVGDELQENYEIIQL
FT                   YIHLLRLSPKEKTTRLLVATLYNLCSSNRTTLLPIAVFLRLPALLTNLSGRHLTDPDLL
FT                   EDLNALSSMLEEYTKTQTTFDEYAAEVQTGHLRWSPPHKNPTFWKDNARRIVEESNGAL
FT                   PKKLAEILSKSWDNDKQVLAIACSDVGHLVKEVPERRGQLERLGLKTRVMELMVDQDES
FT                   VRWESLHAVGEWLRYTFEG"
     MSLEPPTYLS SLQNNIRARP IPWEGAVRAG NITDDHLKKI KAVDKVRKDQ RRQTIEGDLA        60
     AYTGLLAGGA QGKSVLDSAS RRTDIVQYIL VLASDLIQDV PSLASSLVSH PEPYKPFLPF       120
     LQHSTNAEDP IPLLTSTFLT ALVSHSLVAS SKPAPRDNEA LPQLYTYLST LTKNQDSGLQ       180
     DIGVQGFSEL LRTSRAREIF WAQRQETLAP LIDTLRAAAG AKDNVGNAST LGSSSRSVEP       240
     GLAGGVGLQL LYRVLLVLWQ LAFEGALVGD ELQENYEIIQ LYIHLLRLSP KEKTTRLLVA       300
     TLYNLCSSNR TTLLPIAVFL RLPALLTNLS GRHLTDPDLL EDLNALSSML EEYTKTQTTF       360
     DEYAAEVQTG HLRWSPPHKN PTFWKDNARR IVEESNGALP KKLAEILSKS WDNDKQVLAI       420
     ACSDVGHLVK EVPERRGQLE RLGLKTRVME LMVDQDESVR WESLHAVGEW LRYTFEG          477
//

If you have problems or comments...

PBIL Back to PBIL home page