(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE447

PENCW_13.PE447       Location/Qualifiers
FT   CDS             join(1018171..1018366,1018417..1019703,1019752..1019783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948776"
FT                   /orf_name="Pc16g04470"
FT                   /product="Pc16g04470 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93117.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00018316E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R5"
FT                   /transl_table=1
FT                   /translation="MSRSFTGCKRCKARRQKCDEQRPNCGRCQTAGEQCQYAMQLQWGG
FT                   RAFSRSRFGACVGTGGMQRLEYSPGEFIYTTKTAVQPASASTGSDLTLSQPVDPFSSLS
FT                   SSQKALLHHFINDASQITACHSGMQQDICRMLIPMALQTPSLLYATTALSAIHIQALHN
FT                   QSESVKSAPDIARLMALSLEHFRTELQNPSSKDPEALVATARTLCLAEIHSGAINPNSW
FT                   RAHIDGARALMRASDAAGEDSLRSTSGFRRYLDRWYWSIVSLTALTGNGPPIGDISDFA
FT                   SSDLMGLGGSTDYLDDYWGFSVDLAAVFRQIGAAAWRSHEVEKATQGFVAGEVDASVED
FT                   DAASLESAVRQLMDRDSTTQPSFYPSAAKSLSAESAQQLLLCNEAFQHSALIQIHRRLR
FT                   KTPSMSPEVQQSVQRILECTAQIGPSSGLSPWVMLTTPIFIAGCEARGQDRDTVRQLLS
FT                   SLHDTIRVPNVLQSLKFLEQYWANQLSEEEDWSHFLERMQFDFIPY"
     MSRSFTGCKR CKARRQKCDE QRPNCGRCQT AGEQCQYAMQ LQWGGRAFSR SRFGACVGTG        60
     GMQRLEYSPG EFIYTTKTAV QPASASTGSD LTLSQPVDPF SSLSSSQKAL LHHFINDASQ       120
     ITACHSGMQQ DICRMLIPMA LQTPSLLYAT TALSAIHIQA LHNQSESVKS APDIARLMAL       180
     SLEHFRTELQ NPSSKDPEAL VATARTLCLA EIHSGAINPN SWRAHIDGAR ALMRASDAAG       240
     EDSLRSTSGF RRYLDRWYWS IVSLTALTGN GPPIGDISDF ASSDLMGLGG STDYLDDYWG       300
     FSVDLAAVFR QIGAAAWRSH EVEKATQGFV AGEVDASVED DAASLESAVR QLMDRDSTTQ       360
     PSFYPSAAKS LSAESAQQLL LCNEAFQHSA LIQIHRRLRK TPSMSPEVQQ SVQRILECTA       420
     QIGPSSGLSP WVMLTTPIFI AGCEARGQDR DTVRQLLSSL HDTIRVPNVL QSLKFLEQYW       480
     ANQLSEEEDW SHFLERMQFD FIPY                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page