(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE448

PENCW_13.PE448       Location/Qualifiers
FT   CDS             join(1020598..1021414,1021480..1022405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128954"
FT                   /orf_name="Pc16g04480"
FT                   /product="Pc16g04480 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93118.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00018316E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R6"
FT                   /transl_table=1
FT                   /translation="MASIIRDAPFGQLVRLLTNNKYFQYPEEKPDFKLPDTWLQLLNSN
FT                   GDEDDEKKAIQQDSNRSPEDSEPLSRASTQASIEFTEARLEADEQHEIEKIKSIPIAPK
FT                   KTKDGSILVDWYYTDDLENPHNWSNGKRAFITILICLYTFVVYTTSAIYTSSTQGVMKE
FT                   FGVSTLVATLGLSLYVLGYGTGPLVFSPLSEIPVIGRNPVYIITMFLFVIISIPTAFVG
FT                   NFAGLMVLRFLQGFFGSPCLASGGASIGDMYSLMNLPFAMMAWVAAAYCGPALGPLLSG
FT                   FAVPVKGWRWSLFESIWASAPVFILMFMFLPETSSATILLRRAARLRKIHNTNRFMSQS
FT                   ELDQRNMRVSDIAVDALIKPMEITIKDPAVLFVQIYTAIIYGIYYSFFEVFPLVYPVDY
FT                   NMNLGQIGLVFLCVLVSCIIGIAVYASYIHFWMNRRIRRFGFPVNEKLLIPALPASFGP
FT                   LIGLFLFAWTARASIHWIAPTIGITIYGATVFIVMQCIFMYIPLTYPKYAASLFAANDF
FT                   FRSALACGSVLFAHPLFGNLGVARGVSLLGGLSVIGIIGIWLLYFYGGRLRALSKFAIS
FT                   DPVE"
     MASIIRDAPF GQLVRLLTNN KYFQYPEEKP DFKLPDTWLQ LLNSNGDEDD EKKAIQQDSN        60
     RSPEDSEPLS RASTQASIEF TEARLEADEQ HEIEKIKSIP IAPKKTKDGS ILVDWYYTDD       120
     LENPHNWSNG KRAFITILIC LYTFVVYTTS AIYTSSTQGV MKEFGVSTLV ATLGLSLYVL       180
     GYGTGPLVFS PLSEIPVIGR NPVYIITMFL FVIISIPTAF VGNFAGLMVL RFLQGFFGSP       240
     CLASGGASIG DMYSLMNLPF AMMAWVAAAY CGPALGPLLS GFAVPVKGWR WSLFESIWAS       300
     APVFILMFMF LPETSSATIL LRRAARLRKI HNTNRFMSQS ELDQRNMRVS DIAVDALIKP       360
     MEITIKDPAV LFVQIYTAII YGIYYSFFEV FPLVYPVDYN MNLGQIGLVF LCVLVSCIIG       420
     IAVYASYIHF WMNRRIRRFG FPVNEKLLIP ALPASFGPLI GLFLFAWTAR ASIHWIAPTI       480
     GITIYGATVF IVMQCIFMYI PLTYPKYAAS LFAANDFFRS ALACGSVLFA HPLFGNLGVA       540
     RGVSLLGGLS VIGIIGIWLL YFYGGRLRAL SKFAISDPVE                             580
//

If you have problems or comments...

PBIL Back to PBIL home page