(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE449

PENCW_13.PE449       Location/Qualifiers
FT   CDS             join(complement(1024131..1024460),
FT                   complement(1023181..1024079),complement(1022961..1023126))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948777"
FT                   /orf_name="Pc16g04490"
FT                   /product="Pc16g04490 protein"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAP93119.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniParc:UPI00018316E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R7"
FT                   /transl_table=1
FT                   /translation="MRSLVLLSAASALAQTPGDSFYPPKLNDTSYISNSSIETYGGIYE
FT                   APTNGPTGGNPYGTYDYCSMPHPRSEEYELPEALANGSTEGKLVYLEYLQRHQRRTPYN
FT                   ILPGGENQEYHCDDVRPYLYAGPNSASGIQPMPMYAQTYQDPSNPFTPGVNGTCQYPQM
FT                   TIGGVQDGYQHGKDLWGVYGEKLGLIPAKPNSRVWFRSSESALTQASAGAVLRGMWPGH
FT                   KEALPLHQMVTSVNTVNSGYSCPAVSSTLSSMKTTTQWKEHLAVTEELRSELGAMLGAT
FT                   ESSWQSTFDHFADNFQGRLCNGYDLPCSLTNSSSCVTMQMAQEVFRAGDWEWNYYWRTN
FT                   PDVVKYIQVVEGLFIGEIISRLQAVLDGNSSLDYSHIFVHDGDIGPILGALGIETLRWP
FT                   GMASNIAFEVWETKDSKDEASFYARVLYSSHPIRSIHGVLDWVPLSKLIDIMSPYVPED
FT                   ITSLCG"
     MRSLVLLSAA SALAQTPGDS FYPPKLNDTS YISNSSIETY GGIYEAPTNG PTGGNPYGTY        60
     DYCSMPHPRS EEYELPEALA NGSTEGKLVY LEYLQRHQRR TPYNILPGGE NQEYHCDDVR       120
     PYLYAGPNSA SGIQPMPMYA QTYQDPSNPF TPGVNGTCQY PQMTIGGVQD GYQHGKDLWG       180
     VYGEKLGLIP AKPNSRVWFR SSESALTQAS AGAVLRGMWP GHKEALPLHQ MVTSVNTVNS       240
     GYSCPAVSST LSSMKTTTQW KEHLAVTEEL RSELGAMLGA TESSWQSTFD HFADNFQGRL       300
     CNGYDLPCSL TNSSSCVTMQ MAQEVFRAGD WEWNYYWRTN PDVVKYIQVV EGLFIGEIIS       360
     RLQAVLDGNS SLDYSHIFVH DGDIGPILGA LGIETLRWPG MASNIAFEVW ETKDSKDEAS       420
     FYARVLYSSH PIRSIHGVLD WVPLSKLIDI MSPYVPEDIT SLCG                        464
//

If you have problems or comments...

PBIL Back to PBIL home page