(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE45

PENCW_13.PE45        Location/Qualifiers
FT   CDS             join(complement(100521..100697),complement(99550..100455))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945522"
FT                   /orf_name="Pc16g00450"
FT                   /product="Pc16g00450 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92715.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831155"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V6"
FT                   /transl_table=1
FT                   /translation="MSSTDYKFEGWVGLGPEAAQGKMVWQEFEPKPWEETDVDIKVTHC
FT                   GICGSDLHTLRSGWGPTNYPCCVGHEVVGIAVRVGTQVKGDIKVGDRVGVGAQSGSCEN
FT                   KDGDCESCASGLEQHCSKMVGTYNGTYANGGKSYGGYSTYNRSPSHFVIKIPDAISSAD
FT                   AAPMLCGGITTYSPLKRNGCGPGKTVGIVGVGGLGHFAILFAKALGADRVVAISRKSDK
FT                   KEDALKLGADDFIATGEDEDWATRHASSLDLIISTASSSKMPIVQYCGLLRVHGTFIQL
FT                   GAPEDGALEIPAFVLIIKGLKLGGSLIGSPDEIREMLELAAAKGVKPWIQERPMKDANQ
FT                   AIVDMDKGDARYRYVLTNEQ"
     MSSTDYKFEG WVGLGPEAAQ GKMVWQEFEP KPWEETDVDI KVTHCGICGS DLHTLRSGWG        60
     PTNYPCCVGH EVVGIAVRVG TQVKGDIKVG DRVGVGAQSG SCENKDGDCE SCASGLEQHC       120
     SKMVGTYNGT YANGGKSYGG YSTYNRSPSH FVIKIPDAIS SADAAPMLCG GITTYSPLKR       180
     NGCGPGKTVG IVGVGGLGHF AILFAKALGA DRVVAISRKS DKKEDALKLG ADDFIATGED       240
     EDWATRHASS LDLIISTASS SKMPIVQYCG LLRVHGTFIQ LGAPEDGALE IPAFVLIIKG       300
     LKLGGSLIGS PDEIREMLEL AAAKGVKPWI QERPMKDANQ AIVDMDKGDA RYRYVLTNEQ       360
//

If you have problems or comments...

PBIL Back to PBIL home page