(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE450

PENCW_13.PE450       Location/Qualifiers
FT   CDS             join(complement(1025681..1025912),
FT                   complement(1025300..1025637),complement(1024928..1025239))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201342" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948778"
FT                   /orf_name="Pc16g04500"
FT                   /product="Putative uncharacterized protein Pc16g04500 "
FT                   /protein_id="CAP93120.1"
FT                   /db_xref="UniParc:UPI00018316E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R8"
FT                   /transl_table=1
FT                   /translation="MSRPRRNVNFYDGLTGAHLGGVRQNGSITNANFFHMLMDVLLEAD
FT                   GIISIDHRGTGQRMPMNTDRLAEGDYDIFCPRGGIRLTEENFVRRVYSRSRSSRENSFR
FT                   DSVRARDGKCVLTGVVNNGASEGMWTGFEAAHIFPLERRELWRQCNFDRLITRPGRNPI
FT                   NSVQNGMLVSSSVHRLFDSFLISVNPDDCYKITDFAQNNWQADGRVLDIVCLNPNNPDR
FT                   VADDLLRWHFRQSVLANMKEAGEPIFEHDFPPGTDMVKEILQGPFPAERMELELFSRLQ
FT                   STPQENDDESAY"
     MSRPRRNVNF YDGLTGAHLG GVRQNGSITN ANFFHMLMDV LLEADGIISI DHRGTGQRMP        60
     MNTDRLAEGD YDIFCPRGGI RLTEENFVRR VYSRSRSSRE NSFRDSVRAR DGKCVLTGVV       120
     NNGASEGMWT GFEAAHIFPL ERRELWRQCN FDRLITRPGR NPINSVQNGM LVSSSVHRLF       180
     DSFLISVNPD DCYKITDFAQ NNWQADGRVL DIVCLNPNNP DRVADDLLRW HFRQSVLANM       240
     KEAGEPIFEH DFPPGTDMVK EILQGPFPAE RMELELFSRL QSTPQENDDE SAY              293
//

If you have problems or comments...

PBIL Back to PBIL home page