(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE451

PENCW_13.PE451       Location/Qualifiers
FT   CDS             join(complement(1027830..1028033),
FT                   complement(1026210..1027751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824611"
FT                   /orf_name="Pc16g04510"
FT                   /product="Pc16g04510 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93121.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018316E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8R9"
FT                   /transl_table=1
FT                   /translation="MQPGAERGPKHSVYTLPEIPLVNRHADDPRKLRVAVIGAGLSGII
FT                   AGVLLPAKVPGIDLTIFEKNADVGGAWFENIYPGVRCDIPAHVYQSSFEPNTQWSEVYA
FT                   QGAEIRDYWSEAARKYDVYTYLKLSQRVEHLAWDNEQSIWLVKVENLLTGEVYVHEADF
FT                   VLTAIGRFNAWKLPSYQGIEDFKGVIRHASNWDPTFDVSGKRVAVIGNGSTGIQLTTNL
FT                   QSQVARLDHYVRSKTWIATDFIGDSTALQSFPIPKETRDSFNDIDVYLKYRKSIEQSFW
FT                   RGFDGWLKGSESNEHARGEYIRHMKKRLAKKPELAESIIPEFSPSCRRLTPGPGYLEAI
FT                   TAENVDYIQTPIRRFTETGIETVDGKHREVDAVFAATGANIDAVPPFSITAHGKDLTEL
FT                   WSEGGEYGFPYNYIGIATPGFPNLLFILGPNGAGRSGTVPHNVEVQVTLFARILRKVGR
FT                   EGIKTIQPSKKAADDFVQYSDAFWKTTVLSEDCQSWYNGGKPGSRIHGLWPGSSSLVSI
FT                   IYNDPRWEDWEYEYLNDTGNRLAWYFGNGGTKMEADPEHDITSYLIDPAEIDLKKLHEG
FT                   WWSVP"
     MQPGAERGPK HSVYTLPEIP LVNRHADDPR KLRVAVIGAG LSGIIAGVLL PAKVPGIDLT        60
     IFEKNADVGG AWFENIYPGV RCDIPAHVYQ SSFEPNTQWS EVYAQGAEIR DYWSEAARKY       120
     DVYTYLKLSQ RVEHLAWDNE QSIWLVKVEN LLTGEVYVHE ADFVLTAIGR FNAWKLPSYQ       180
     GIEDFKGVIR HASNWDPTFD VSGKRVAVIG NGSTGIQLTT NLQSQVARLD HYVRSKTWIA       240
     TDFIGDSTAL QSFPIPKETR DSFNDIDVYL KYRKSIEQSF WRGFDGWLKG SESNEHARGE       300
     YIRHMKKRLA KKPELAESII PEFSPSCRRL TPGPGYLEAI TAENVDYIQT PIRRFTETGI       360
     ETVDGKHREV DAVFAATGAN IDAVPPFSIT AHGKDLTELW SEGGEYGFPY NYIGIATPGF       420
     PNLLFILGPN GAGRSGTVPH NVEVQVTLFA RILRKVGREG IKTIQPSKKA ADDFVQYSDA       480
     FWKTTVLSED CQSWYNGGKP GSRIHGLWPG SSSLVSIIYN DPRWEDWEYE YLNDTGNRLA       540
     WYFGNGGTKM EADPEHDITS YLIDPAEIDL KKLHEGWWSV P                           581
//

If you have problems or comments...

PBIL Back to PBIL home page