(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE452

PENCW_13.PE452       Location/Qualifiers
FT   CDS             join(complement(1030869..1030872),
FT                   complement(1028913..1030810))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948779"
FT                   /orf_name="Pc16g04520"
FT                   /product="Pc16g04520 protein"
FT                   /function="ATP binding"
FT                   /function="D-alanine-D-alanine ligase activity "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /protein_id="CAP93122.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008716"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniParc:UPI00018316E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S0"
FT                   /transl_table=1
FT                   /translation="MDSNDATWAWKLDTLPEETTTIVLNIYPKNISDTSTKSSTEGSAH
FT                   AATQFLLEHLPKGNGLVKLLLPLQSGYIVQSDFLERRMVDCLNVTKLQGFVTPGKHIRG
FT                   YTAEVYHGMSISSLLSYSYGAIVVQNDSSLSIETMSTAINDQLVNRLSFPWLSSTPIPR
FT                   KRLALVGASSLTKAQGYLLAAASLNIAIVVFDEPSHWLSDNSYSHLREDFVPLDMAIDM
FT                   DMAHRIAAALKRYQNSMEEKPIDGVMSFDERFHTIIAHVATQLDFKTSPPESVGLVQNK
FT                   FKARQLDTNDFCRLVRSPEDLENMLSKDGPQLAYPLIIKPAKGWCSEGVWKVANEQELL
FT                   EKVHLLWRESFTAWHGNEVVIETYVEGPEIDANIVLVDGEIVVFEANDDFPCTGDYNDK
FT                   SGGRVQNFVETSNMLPSALPPYELRSVQQRLHELALAAGFRNAILHIEAKLRNSSCHYV
FT                   KTDSDGLVDLELKTPATTTTQPKDVFLIEINPRAPGWQEVEATARTYGVCYYSISLLNA
FT                   LADKERIVSLSKPFLGGPQYHMQLLYVSVQKGGIYKFGDICKRVLQAPGQEHQLSAHVV
FT                   KSTNLLEDGEEVLDPSTGQVYGTFIAIFLVISRTSRKEAMRIGNEIERLVREYTDGF"
     MDSNDATWAW KLDTLPEETT TIVLNIYPKN ISDTSTKSST EGSAHAATQF LLEHLPKGNG        60
     LVKLLLPLQS GYIVQSDFLE RRMVDCLNVT KLQGFVTPGK HIRGYTAEVY HGMSISSLLS       120
     YSYGAIVVQN DSSLSIETMS TAINDQLVNR LSFPWLSSTP IPRKRLALVG ASSLTKAQGY       180
     LLAAASLNIA IVVFDEPSHW LSDNSYSHLR EDFVPLDMAI DMDMAHRIAA ALKRYQNSME       240
     EKPIDGVMSF DERFHTIIAH VATQLDFKTS PPESVGLVQN KFKARQLDTN DFCRLVRSPE       300
     DLENMLSKDG PQLAYPLIIK PAKGWCSEGV WKVANEQELL EKVHLLWRES FTAWHGNEVV       360
     IETYVEGPEI DANIVLVDGE IVVFEANDDF PCTGDYNDKS GGRVQNFVET SNMLPSALPP       420
     YELRSVQQRL HELALAAGFR NAILHIEAKL RNSSCHYVKT DSDGLVDLEL KTPATTTTQP       480
     KDVFLIEINP RAPGWQEVEA TARTYGVCYY SISLLNALAD KERIVSLSKP FLGGPQYHMQ       540
     LLYVSVQKGG IYKFGDICKR VLQAPGQEHQ LSAHVVKSTN LLEDGEEVLD PSTGQVYGTF       600
     IAIFLVISRT SRKEAMRIGN EIERLVREYT DGF                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page