(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE456

PENCW_13.PE456       Location/Qualifiers
FT   CDS             join(complement(1043912..1043999),
FT                   complement(1043740..1043862),complement(1043613..1043692),
FT                   complement(1043214..1043532),complement(1042516..1043151),
FT                   complement(1041997..1042457))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948781"
FT                   /orf_name="Pc16g04560"
FT                   /product="Pc16g04560 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93126.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018317BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8S4"
FT                   /transl_table=1
FT                   /translation="MSATINTRLPVGNKDFTNATVVIIGAGISGMCMAIDLIKRNKTQN
FT                   FVVLERSSSVGGTWNDNKYPGCCCDVFSSLYSYSFEQNPNWSREYPGQEEIHAYLVGVA
FT                   EKYGLYKHIRFNSTVEEARWDDTESKWRTSVVISGQKDSEFSSSYVLNSDFLVSAVGQL
FT                   NLPRAPDISGLADFQGKMMHSARWDWSYDMTGKRIAIIGNGATAAQIAPEVARVASHLT
FT                   IYQRTPNWVIPRLDQPVSTLQKTLFKWVPPLHWRKRALQMKFREDLFGAITDGDSELSH
FT                   MLRTLCTNAIKSQLPDRPDLWDSLTPSYAPGCKRIIITDDYYPTLARDNVHLETRGITC
FT                   VTDSGIKVDEEEQEHDLIVLATGFKTVEFMHPIRIYGTNGRPLEDIWRNGATALNGVTV
FT                   EDLPNFGMFYGPNTNLGHNSIILMIEAQSRYLNVLVGEVMQARQQGKTLALKPEPGALK
FT                   SYNDRIQAILRRTSFADPNCNSWYKRDDGVITNNWCGTVIDYQRELSKVQWQDYIAEGT
FT                   GKDRVMDKAATKVSHAQEEILLSNSSLLVGAIGILSATGYFVARSRRLKAH"
     MSATINTRLP VGNKDFTNAT VVIIGAGISG MCMAIDLIKR NKTQNFVVLE RSSSVGGTWN        60
     DNKYPGCCCD VFSSLYSYSF EQNPNWSREY PGQEEIHAYL VGVAEKYGLY KHIRFNSTVE       120
     EARWDDTESK WRTSVVISGQ KDSEFSSSYV LNSDFLVSAV GQLNLPRAPD ISGLADFQGK       180
     MMHSARWDWS YDMTGKRIAI IGNGATAAQI APEVARVASH LTIYQRTPNW VIPRLDQPVS       240
     TLQKTLFKWV PPLHWRKRAL QMKFREDLFG AITDGDSELS HMLRTLCTNA IKSQLPDRPD       300
     LWDSLTPSYA PGCKRIIITD DYYPTLARDN VHLETRGITC VTDSGIKVDE EEQEHDLIVL       360
     ATGFKTVEFM HPIRIYGTNG RPLEDIWRNG ATALNGVTVE DLPNFGMFYG PNTNLGHNSI       420
     ILMIEAQSRY LNVLVGEVMQ ARQQGKTLAL KPEPGALKSY NDRIQAILRR TSFADPNCNS       480
     WYKRDDGVIT NNWCGTVIDY QRELSKVQWQ DYIAEGTGKD RVMDKAATKV SHAQEEILLS       540
     NSSLLVGAIG ILSATGYFVA RSRRLKAH                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page