(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE457

PENCW_13.PE457       Location/Qualifiers
FT   CDS             join(complement(1045434..1045485),
FT                   complement(1045355..1045380),complement(1045129..1045257),
FT                   complement(1044917..1045039),complement(1044528..1044857),
FT                   complement(1044409..1044462))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948782"
FT                   /orf_name="Pc16g04570"
FT                   /product="Pc16g04570 protein"
FT                   /protein_id="CAP93127.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00018317BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H904"
FT                   /transl_table=1
FT                   /translation="MDSDQKFALHEAAREGRNEVVESLLNANPKSAFVKDDDERLPIHW
FT                   AAAYNRVPVVELLVAMKDFDPDVEDGSGWTPLMIAASLKDAAGDATIDLLLRKGAGVSI
FT                   KSNSGQNALHFASSKANISTVRTLLANKCSARVKDRRGQLPLHRAAAVGSVPILKTLLE
FT                   EGKSPVNATDGDGFTALHHAISEGHGPAAILLLKSGAEAEKRDSEGRLAIELVPDDKVK
FT                   QYILQTAEREGIELP"
     MDSDQKFALH EAAREGRNEV VESLLNANPK SAFVKDDDER LPIHWAAAYN RVPVVELLVA        60
     MKDFDPDVED GSGWTPLMIA ASLKDAAGDA TIDLLLRKGA GVSIKSNSGQ NALHFASSKA       120
     NISTVRTLLA NKCSARVKDR RGQLPLHRAA AVGSVPILKT LLEEGKSPVN ATDGDGFTAL       180
     HHAISEGHGP AAILLLKSGA EAEKRDSEGR LAIELVPDDK VKQYILQTAE REGIELP          237
//

If you have problems or comments...

PBIL Back to PBIL home page