(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE458

PENCW_13.PE458       Location/Qualifiers
FT   CDS             1046246..1047604
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128956"
FT                   /orf_name="Pc16g04580"
FT                   /product="Pc16g04580 protein"
FT                   /protein_id="CAP93128.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018317BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y8"
FT                   /transl_table=1
FT                   /translation="MEYNSPQSADDAVRMSAKRTAELFGTEYLMVTPTTLTDSSIGVSY
FT                   RRKAEYADITELPRALAEKQAKATAGRTKRPKIQAQAPADGSGSSMSLVRRPSGAGAGA
FT                   GVAGGDQPKSLIQRPSATKQQRPEWHAPWKLMRVISGHLGWVRSLAVEPNNQWFASGAG
FT                   DRTIKIWNLATGALRLTLTGHISTVRGLAVSPRHPYLFSCGEDKMVKCWDLETNKVIRH
FT                   YHGHLSGVYTLALHPRLDLLVTGGRDGVCRVWDMRTRSNIHVLSGHKGTVADIKCQDAD
FT                   PQIISGSLDSTVRLWDLAAGKSMGVLTHHKKGVRNLAIHPTEFTFASASTGSIKQWMCP
FT                   KGDFMQNFEGQNSVINSLAVNDENVLFSGGDDGSMSFWDWKTGHRFQSMETTAQPGSLE
FT                   AEAGVMASTFDRTGLRLITGEADKTIKIWKQDEQATPETHPLTWAPTLGRQRY"
     MEYNSPQSAD DAVRMSAKRT AELFGTEYLM VTPTTLTDSS IGVSYRRKAE YADITELPRA        60
     LAEKQAKATA GRTKRPKIQA QAPADGSGSS MSLVRRPSGA GAGAGVAGGD QPKSLIQRPS       120
     ATKQQRPEWH APWKLMRVIS GHLGWVRSLA VEPNNQWFAS GAGDRTIKIW NLATGALRLT       180
     LTGHISTVRG LAVSPRHPYL FSCGEDKMVK CWDLETNKVI RHYHGHLSGV YTLALHPRLD       240
     LLVTGGRDGV CRVWDMRTRS NIHVLSGHKG TVADIKCQDA DPQIISGSLD STVRLWDLAA       300
     GKSMGVLTHH KKGVRNLAIH PTEFTFASAS TGSIKQWMCP KGDFMQNFEG QNSVINSLAV       360
     NDENVLFSGG DDGSMSFWDW KTGHRFQSME TTAQPGSLEA EAGVMASTFD RTGLRLITGE       420
     ADKTIKIWKQ DEQATPETHP LTWAPTLGRQ RY                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page