(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE459

PENCW_13.PE459       Location/Qualifiers
FT   CDS             join(complement(1049721..1050494),
FT                   complement(1049544..1049665),complement(1048977..1049489),
FT                   complement(1048022..1048802))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824613"
FT                   /orf_name="Pc16g04590"
FT                   /product="Pc16g04590 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="CAP93129.1"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR020793"
FT                   /db_xref="UniParc:UPI00018317C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y9"
FT                   /transl_table=1
FT                   /translation="MSDSDSESSPQRRSARERAQWMTKGALVRDDSDDELGVEDLPWNW
FT                   IYDTNEETTQETENNDDTPAKRSRRRSSRPARKKRKIVGAQMGQFQCKVGDVILLKSPE
FT                   AGKDWVGIVTEFLEEDDEDEEDEIVKSANIMWFASPDEFMGTRNKRRTDALPNEQYITL
FT                   DFNSNPLTSISGKGTVMSQSAFNAKYPNGPPKNKTELAEYHKCIVCRRGVNQVQGRYTE
FT                   EFIWEQVYDEDNIHNLINWVRDGLKASRKRKVADDEYVDTKETTVPTTPRKRQRLAATN
FT                   ATPQSQRKKSLMTPTHKRIVVKKPLEFTPLGTRVLSPTHFDSPYRQARNLLHVSTVPDS
FT                   LPCRKTEFNTVYNHLSAAIMEGTGACIYISGTPGTGKTATVREVVAQLNAAVHEEEMDD
FT                   FIFVEINGMKVTDPHQSYSLLWEALKGDRVSPSHALDLLEREFSNPSPRRVSCVVLMDE
FT                   LDQLVTKNQSVITRLANVPGNIVDPDAVQFASRKVAAVSGDARRALDICRRAVEIAEQA
FT                   ADEAAAADEAKDETESLPPTPSKTPARRNNAIAAKEAGTSAVAKPPAKGQPGRVTIATI
FT                   KQAIHEATSTPLQQSLRCLPLSGKLFLAALLARVHRTGISESTFGDVLDEARRIADAAV
FT                   AVAGAAGAGVKDFLLGGGPSARVRSLGHAAMSLMNSGVLALEQGSGSKSVLGGTTIPTR
FT                   GDRSSKVRLRVAAEDVRSAFREDAEAKGFGLGIER"
     MSDSDSESSP QRRSARERAQ WMTKGALVRD DSDDELGVED LPWNWIYDTN EETTQETENN        60
     DDTPAKRSRR RSSRPARKKR KIVGAQMGQF QCKVGDVILL KSPEAGKDWV GIVTEFLEED       120
     DEDEEDEIVK SANIMWFASP DEFMGTRNKR RTDALPNEQY ITLDFNSNPL TSISGKGTVM       180
     SQSAFNAKYP NGPPKNKTEL AEYHKCIVCR RGVNQVQGRY TEEFIWEQVY DEDNIHNLIN       240
     WVRDGLKASR KRKVADDEYV DTKETTVPTT PRKRQRLAAT NATPQSQRKK SLMTPTHKRI       300
     VVKKPLEFTP LGTRVLSPTH FDSPYRQARN LLHVSTVPDS LPCRKTEFNT VYNHLSAAIM       360
     EGTGACIYIS GTPGTGKTAT VREVVAQLNA AVHEEEMDDF IFVEINGMKV TDPHQSYSLL       420
     WEALKGDRVS PSHALDLLER EFSNPSPRRV SCVVLMDELD QLVTKNQSVI TRLANVPGNI       480
     VDPDAVQFAS RKVAAVSGDA RRALDICRRA VEIAEQAADE AAAADEAKDE TESLPPTPSK       540
     TPARRNNAIA AKEAGTSAVA KPPAKGQPGR VTIATIKQAI HEATSTPLQQ SLRCLPLSGK       600
     LFLAALLARV HRTGISESTF GDVLDEARRI ADAAVAVAGA AGAGVKDFLL GGGPSARVRS       660
     LGHAAMSLMN SGVLALEQGS GSKSVLGGTT IPTRGDRSSK VRLRVAAEDV RSAFREDAEA       720
     KGFGLGIER                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page