(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE46

PENCW_13.PE46        Location/Qualifiers
FT   CDS             join(101051..101171,101481..101532,101633..101659,
FT                   101996..102197,102685..102882)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945523"
FT                   /orf_name="Pc16g00460"
FT                   /product="Putative uncharacterized protein Pc16g00460 "
FT                   /protein_id="CAP92716.1"
FT                   /db_xref="UniParc:UPI0001831156"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V7"
FT                   /transl_table=1
FT                   /translation="MTWISTYPGDLRWLVLTCCIGVKGMPSPWFMPAYARQGKGVGILM
FT                   GFGFLKEENSRTGRKKLAQLVRLSVGRLALVPGGSAEWLPLSLSTCTACILNGVITPTR
FT                   SLFDFENIEHGQQSRQVFSARIITLSAAYGAWLDFALAFVFVICPGLAVPPTVPPYSLA
FT                   FALAHDQNPAPLLQLKVRELNKVLRHAKLGHLYPLA"
     MTWISTYPGD LRWLVLTCCI GVKGMPSPWF MPAYARQGKG VGILMGFGFL KEENSRTGRK        60
     KLAQLVRLSV GRLALVPGGS AEWLPLSLST CTACILNGVI TPTRSLFDFE NIEHGQQSRQ       120
     VFSARIITLS AAYGAWLDFA LAFVFVICPG LAVPPTVPPY SLAFALAHDQ NPAPLLQLKV       180
     RELNKVLRHA KLGHLYPLA                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page