(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE460

PENCW_13.PE460       Location/Qualifiers
FT   CDS             join(1051730..1051761,1051818..1051840,1051892..1052470,
FT                   1052519..1052561,1052617..1052719,1052746..1053006,
FT                   1053080..1053666,1053723..1054013,1054069..1054672)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948783"
FT                   /orf_name="Pc16g04600"
FT                   /product="Pc16g04600 protein"
FT                   /protein_id="CAP93130.1"
FT                   /db_xref="UniParc:UPI00018317C1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z0"
FT                   /transl_table=1
FT                   /translation="MAALPESYETDWERINAKSWELPNYGPGPDFSGGTIYRQDDNEHA
FT                   YKTSPDHDDEGGFEDANYGSPPVNYPPRPPTSTVPVTGRSLPSVPPPPTRRPIPNQSVL
FT                   PTQAVITGARTSQAQAPEGPILNERGPNTSNSNTLAPQPHHASRNPRSGQRTPRRGAHT
FT                   DTPRARFQSKKGSSASAQSQHRAKNPPNAPGQNDSYSKAKWRKGLSPDASYRLPYECQV
FT                   FQEKIRQVTSGEASNIDFRQRIIEETDAYVRISAGNAKIREAQYTDNAKLLHIWGRQNQ
FT                   VLAAQNLLQDMLNQLMQQGTSAKAPSRWTKIHAHSNTKVAHARTRESHQERLSEMRKPP
FT                   KIATDYTLGFLWPPDGPSLNYFVTARRELLDFIRLKYDVNIYIKPGIPDYLFMSGNNER
FT                   DMCIIASRFRELWERLMVQHETEIKLFLVAAPRAEVMRTHVLLQKSGGLSTPVICGPEL
FT                   APEVAANWKTTADEIKLSNKNMVTTRLRKALHVIPQFRGFLQMRAKFGSFALQQWRKPK
FT                   DGTSYEFSEFREMLTHMNTEGRLLPGIRLQQDEIFNRIIESTFLKPWGKAKIKSLLSLM
FT                   PRYSANFEYQVNNESVIRVEAKFSLPVGSQEFEVNGIRCFKSKQIGAPVDRQMPMQISM
FT                   IDFERSDWQLEVKALELCPENEIPPDLDKFMRSIGFQWNANAKSIGSAPKRKARFSYGS
FT                   PIKRFVEKATIQLQVKDSPHVFELARFDEYTYAAGQWSMNPKVSWGASLFNPDWDDILG
FT                   EQADIKVLDTSKDACLSVFFPPPGDGEERTEKQKTDDELRKEAEIRKVEEEKQLGLFMS
FT                   TVQQVARMLGNPGAEMPDVLETDLGSLF"
     MAALPESYET DWERINAKSW ELPNYGPGPD FSGGTIYRQD DNEHAYKTSP DHDDEGGFED        60
     ANYGSPPVNY PPRPPTSTVP VTGRSLPSVP PPPTRRPIPN QSVLPTQAVI TGARTSQAQA       120
     PEGPILNERG PNTSNSNTLA PQPHHASRNP RSGQRTPRRG AHTDTPRARF QSKKGSSASA       180
     QSQHRAKNPP NAPGQNDSYS KAKWRKGLSP DASYRLPYEC QVFQEKIRQV TSGEASNIDF       240
     RQRIIEETDA YVRISAGNAK IREAQYTDNA KLLHIWGRQN QVLAAQNLLQ DMLNQLMQQG       300
     TSAKAPSRWT KIHAHSNTKV AHARTRESHQ ERLSEMRKPP KIATDYTLGF LWPPDGPSLN       360
     YFVTARRELL DFIRLKYDVN IYIKPGIPDY LFMSGNNERD MCIIASRFRE LWERLMVQHE       420
     TEIKLFLVAA PRAEVMRTHV LLQKSGGLST PVICGPELAP EVAANWKTTA DEIKLSNKNM       480
     VTTRLRKALH VIPQFRGFLQ MRAKFGSFAL QQWRKPKDGT SYEFSEFREM LTHMNTEGRL       540
     LPGIRLQQDE IFNRIIESTF LKPWGKAKIK SLLSLMPRYS ANFEYQVNNE SVIRVEAKFS       600
     LPVGSQEFEV NGIRCFKSKQ IGAPVDRQMP MQISMIDFER SDWQLEVKAL ELCPENEIPP       660
     DLDKFMRSIG FQWNANAKSI GSAPKRKARF SYGSPIKRFV EKATIQLQVK DSPHVFELAR       720
     FDEYTYAAGQ WSMNPKVSWG ASLFNPDWDD ILGEQADIKV LDTSKDACLS VFFPPPGDGE       780
     ERTEKQKTDD ELRKEAEIRK VEEEKQLGLF MSTVQQVARM LGNPGAEMPD VLETDLGSLF       840
//

If you have problems or comments...

PBIL Back to PBIL home page