(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE461

PENCW_13.PE461       Location/Qualifiers
FT   CDS             join(complement(1055770..1055806),
FT                   complement(1055382..1055668),complement(1055199..1055316),
FT                   complement(1055050..1055102))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128957"
FT                   /orf_name="Pc16g04610"
FT                   /product="Pc16g04610 protein"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAP93131.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniParc:UPI00018317C2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z1"
FT                   /transl_table=1
FT                   /translation="MSQNTDGAPQGSINLASLSVPQLRALQTRLTSELEHLTTSHTKLR
FT                   AAQAKFRDCVRSINDGVTGNAKKGTDGRDEILVPLTSSLYVKGRLTDREKVLVDVGTGF
FT                   YVEKTAPKAVAFYDEKVKGLDANLQELEKIVQTKSSQLRIVEETLRQKMLSEGAPQAAA
FT                   G"
     MSQNTDGAPQ GSINLASLSV PQLRALQTRL TSELEHLTTS HTKLRAAQAK FRDCVRSIND        60
     GVTGNAKKGT DGRDEILVPL TSSLYVKGRL TDREKVLVDV GTGFYVEKTA PKAVAFYDEK       120
     VKGLDANLQE LEKIVQTKSS QLRIVEETLR QKMLSEGAPQ AAAG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page