(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE462

PENCW_13.PE462       Location/Qualifiers
FT   CDS             join(1056266..1056441,1056544..1057229,1057284..1057692,
FT                   1057751..1058039,1058089..1058481)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671907"
FT                   /orf_name="Pc16g04620"
FT                   /product="Pc16g04620 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93132.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018317C3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z2"
FT                   /transl_table=1
FT                   /translation="MASRLAACEACRKAKVACDHKRPACTRCASNDRAGICIYRTTPFK
FT                   RRRVSSSTPVQSPRSNPYPNPGFLGSSSHVAIFNEISPQDYHASDTYHASEDMTMLMQS
FT                   QSTGENILLIQGADVLRQLLNTFPLAAMKDFVTFWLATGANLALAEPFTEKCTENMTRL
FT                   FTSFSQEDNWHLAYAQRLTQNSREPLQFNSTSDMESFSAQFLDQKFRWESLGIFLSAVT
FT                   RAAIDISFFPPLFKTEKDQFMLRKLSTKLSDLALDIALSLDCLNDLQLVLQYENCIVHT
FT                   HVDGDQSYHSWSRLGDVVSSMFALGYHENVDKTKPPIPIFLAELRKTAWATTYSADKNI
FT                   AIFLGRPPRMSKRFCHFQVPLSPTSSDQVSNTSHVEDEVVRWKTDTPICYRSGIRWATL
FT                   CSALKEDVLELLRSKQRDNFSQKASIIRQKAETQWAHLPPHFHLSGSLKECSGDAFERD
FT                   LLASIRLDQLHVLFLLQLSFLDTLTEPDSSILDISDQMLSLVVDAILLRDQLVNSGTGL
FT                   VWKIAHFGLPAAGIILLSMLKQHRTLTEARSSWSKTILNLGIFVAQVQVGSIVRRGDPN
FT                   YALVSKATQTIERFLDSIHREGIQSPTQPPPHLGENGDWASFFSQDLCDFETDFWENLA
FT                   YHPSLLASDPTLPAI"
     MASRLAACEA CRKAKVACDH KRPACTRCAS NDRAGICIYR TTPFKRRRVS SSTPVQSPRS        60
     NPYPNPGFLG SSSHVAIFNE ISPQDYHASD TYHASEDMTM LMQSQSTGEN ILLIQGADVL       120
     RQLLNTFPLA AMKDFVTFWL ATGANLALAE PFTEKCTENM TRLFTSFSQE DNWHLAYAQR       180
     LTQNSREPLQ FNSTSDMESF SAQFLDQKFR WESLGIFLSA VTRAAIDISF FPPLFKTEKD       240
     QFMLRKLSTK LSDLALDIAL SLDCLNDLQL VLQYENCIVH THVDGDQSYH SWSRLGDVVS       300
     SMFALGYHEN VDKTKPPIPI FLAELRKTAW ATTYSADKNI AIFLGRPPRM SKRFCHFQVP       360
     LSPTSSDQVS NTSHVEDEVV RWKTDTPICY RSGIRWATLC SALKEDVLEL LRSKQRDNFS       420
     QKASIIRQKA ETQWAHLPPH FHLSGSLKEC SGDAFERDLL ASIRLDQLHV LFLLQLSFLD       480
     TLTEPDSSIL DISDQMLSLV VDAILLRDQL VNSGTGLVWK IAHFGLPAAG IILLSMLKQH       540
     RTLTEARSSW SKTILNLGIF VAQVQVGSIV RRGDPNYALV SKATQTIERF LDSIHREGIQ       600
     SPTQPPPHLG ENGDWASFFS QDLCDFETDF WENLAYHPSL LASDPTLPAI                  650
//

If you have problems or comments...

PBIL Back to PBIL home page