(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE463

PENCW_13.PE463       Location/Qualifiers
FT   CDS             complement(1059392..1061068)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948784"
FT                   /orf_name="Pc16g04630"
FT                   /product="Pc16g04630 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAP93133.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI00018317C4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z3"
FT                   /transl_table=1
FT                   /translation="MNSLILSLFFISAAASQSYLPSEQIDVQSSLLSDPNQVAGKTVDY
FT                   IIAGGGLTGLTVAAKLTENPNITVLVIENGFYESADGAIIEDLNAYGDIFRTTVDHAYE
FT                   TVPHAINNRTENIRSGNGLGGSTLINGGSWTRPHKAQIDSWERVFGNKGWNWDYLFPYM
FT                   QKVETSRPPNDVEIAAGHYYDSACHGTNGTVHSGFRNTGEVYSPIIKAFMNSSEERGVP
FT                   TKLDFHCGVPRGVSMIPNSLHKDQTRSDAAREWLLPNYKRPNLQVLTGQFVGKVLINQT
FT                   TISGHKTGHKAVGVNFGTNKHVNFNVYAKHEVLLAAGSAVSPRILEYSGIGLKPVLDAA
FT                   GVQQIVDLPVGLNMQDQTTTTVASRTKPSGNGQGQAIYYATFNETFGDFAPQAHHLLNT
FT                   KLHQWASETVARGGFHNVTALEIQYQNYRDWLNDEVVMTDLMEAPSPPGTGIDVSAPTI
FT                   ERESRKRSRDDDGEQDDPSSPPQKKQSEWANFTTLSDSSSGGDQPEPDADGDIPMDDET
FT                   YKPYKIANTSGETDSSVWSTMRGYLGLTGRGSTPPEQPEEL"
     MNSLILSLFF ISAAASQSYL PSEQIDVQSS LLSDPNQVAG KTVDYIIAGG GLTGLTVAAK        60
     LTENPNITVL VIENGFYESA DGAIIEDLNA YGDIFRTTVD HAYETVPHAI NNRTENIRSG       120
     NGLGGSTLIN GGSWTRPHKA QIDSWERVFG NKGWNWDYLF PYMQKVETSR PPNDVEIAAG       180
     HYYDSACHGT NGTVHSGFRN TGEVYSPIIK AFMNSSEERG VPTKLDFHCG VPRGVSMIPN       240
     SLHKDQTRSD AAREWLLPNY KRPNLQVLTG QFVGKVLINQ TTISGHKTGH KAVGVNFGTN       300
     KHVNFNVYAK HEVLLAAGSA VSPRILEYSG IGLKPVLDAA GVQQIVDLPV GLNMQDQTTT       360
     TVASRTKPSG NGQGQAIYYA TFNETFGDFA PQAHHLLNTK LHQWASETVA RGGFHNVTAL       420
     EIQYQNYRDW LNDEVVMTDL MEAPSPPGTG IDVSAPTIER ESRKRSRDDD GEQDDPSSPP       480
     QKKQSEWANF TTLSDSSSGG DQPEPDADGD IPMDDETYKP YKIANTSGET DSSVWSTMRG       540
     YLGLTGRGST PPEQPEEL                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page