(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE464

PENCW_13.PE464       Location/Qualifiers
FT   CDS             1062598..1064040
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948785"
FT                   /orf_name="Pc16g04640"
FT                   /product="Pc16g04640 protein"
FT                   /function="D-arabinono-1,4-lactone oxidase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93134.1"
FT                   /db_xref="GO:0003885"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI00018317C5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z4"
FT                   /transl_table=1
FT                   /translation="MLSPKPAFLLLLLHAVFGSAYRWFNWQLEVTCQSDAYIAPHNEHA
FT                   AAEFLKEQYPKGSHIKVVGNGHGFGNLTTCVDNALTEKPTYIVSLTNLKKLHIDKKNLT
FT                   VTFGAGWDVDDLIQELKANDLSFSNLGVERVQNFVGAASTGTHGSGSDLGNIATQIIGL
FT                   RVLDSQGGLRVINEKHNAEELKAFRISLGALGLITELTIKVQPTQLLKKTTKVLNATSD
FT                   YSKMYNELAQLYKEHDRMTVWGPHFDWNAKSQSWDLEPTYFLSYWEPTNYTGVRNCTLN
FT                   HCANGCGDCKKEYICYDEVTDAASCSPQGVCSRGFYAEIEHFLPIEYFAEAATNYTIFQ
FT                   QGQTSRMKAPYNKQMVMQHRSLKGDDTYLSPVNTYNLGPDLSGVFGVIEIDWIQEYNNF
FT                   TTLWQNQELAHEFLPQFGETYNARSHWNKMSAPNATYTLEKFPKLPEFLAIQKRQDPKC
FT                   QFVNEFLVEQLGITRCANYISV"
     MLSPKPAFLL LLLHAVFGSA YRWFNWQLEV TCQSDAYIAP HNEHAAAEFL KEQYPKGSHI        60
     KVVGNGHGFG NLTTCVDNAL TEKPTYIVSL TNLKKLHIDK KNLTVTFGAG WDVDDLIQEL       120
     KANDLSFSNL GVERVQNFVG AASTGTHGSG SDLGNIATQI IGLRVLDSQG GLRVINEKHN       180
     AEELKAFRIS LGALGLITEL TIKVQPTQLL KKTTKVLNAT SDYSKMYNEL AQLYKEHDRM       240
     TVWGPHFDWN AKSQSWDLEP TYFLSYWEPT NYTGVRNCTL NHCANGCGDC KKEYICYDEV       300
     TDAASCSPQG VCSRGFYAEI EHFLPIEYFA EAATNYTIFQ QGQTSRMKAP YNKQMVMQHR       360
     SLKGDDTYLS PVNTYNLGPD LSGVFGVIEI DWIQEYNNFT TLWQNQELAH EFLPQFGETY       420
     NARSHWNKMS APNATYTLEK FPKLPEFLAI QKRQDPKCQF VNEFLVEQLG ITRCANYISV       480
//

If you have problems or comments...

PBIL Back to PBIL home page