(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE465

PENCW_13.PE465       Location/Qualifiers
FT   CDS             join(1064928..1065002,1065074..1065153,1065267..1065334,
FT                   1065407..1066218)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227426" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128958"
FT                   /orf_name="Pc16g04650"
FT                   /product="Pc16g04650 protein"
FT                   /function="ATP binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /function="damaged DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAP93135.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011941"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI00018317C6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z5"
FT                   /transl_table=1
FT                   /translation="MEGEEQFDENGLPGPGAPTPLSALDGVSGLTARDIKLFVDAGYHT
FT                   VESVAYTPKRLLEQIKGISEQKATKILVEASKLVPMGFTTATEMHARRSELISITTGSK
FT                   RLDTLLGGGVETGSITEIFGEFRTGKSQICHTLAVTCQLPFDMGGGEGKCLYIDTEGTF
FT                   RPVRLLAVAQRYGLVGEEVLDNVAYARAYNSDHQLQLLNQASQMMCETRFSLLVVDSAT
FT                   SLYRTDFNGRGELASRQTHLAKFMRTLQRLADEFGIAVVITNQVVAQVDGGPSAMFNPD
FT                   PKKPIGGNIIAHASTTRLSLKKGRGETRICKIYDSPCLPEGDCLFAINEDGIGDPSEKD
FT                   LEDK"
     MEGEEQFDEN GLPGPGAPTP LSALDGVSGL TARDIKLFVD AGYHTVESVA YTPKRLLEQI        60
     KGISEQKATK ILVEASKLVP MGFTTATEMH ARRSELISIT TGSKRLDTLL GGGVETGSIT       120
     EIFGEFRTGK SQICHTLAVT CQLPFDMGGG EGKCLYIDTE GTFRPVRLLA VAQRYGLVGE       180
     EVLDNVAYAR AYNSDHQLQL LNQASQMMCE TRFSLLVVDS ATSLYRTDFN GRGELASRQT       240
     HLAKFMRTLQ RLADEFGIAV VITNQVVAQV DGGPSAMFNP DPKKPIGGNI IAHASTTRLS       300
     LKKGRGETRI CKIYDSPCLP EGDCLFAINE DGIGDPSEKD LEDK                        344
//

If you have problems or comments...

PBIL Back to PBIL home page