(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE469

PENCW_13.PE469       Location/Qualifiers
FT   CDS             join(1080827..1081309,1081382..1081798,1081865..1082167,
FT                   1082222..1093826,1093878..1094969,1095018..1096633,
FT                   1096684..1099362)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948786"
FT                   /orf_name="Pc16g04690"
FT                   /product="Pc16g04690 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="CAP93139.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001834909"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Z9"
FT                   /transl_table=1
FT                   /translation="MAQSTKCYLPRFASTVDGPKRPVSMKTRPTAAQHAQLLTAWNEGR
FT                   LDPILRATWALLLHYYIRSEDICFGYQHLEGDSRSPKSSVQRSTVNISTIRISINDNDS
FT                   LKAIVDKVRANSAIRQNNGSPEASEAYLPFNTIFMLRTYDPPASPSKPILATAIPDECQ
FT                   VRLHVKVLRGDISIFLEWRKGDMSGEQMKSIANIFEQLLAKVLSAENTAISQLNLFSEN
FT                   DWQRIRKWNSTTPQLHDRCIHEAIHDQMLSGPDREAVCAWDGSLTFAELDHQASKLACY
FT                   LRMQGVGPEIRVALCFDKSKWNIVAMLGVMKAGGAFVPLDPSHPTSRLQGLIQSVEAPV
FT                   VLCSQHLADKLRPIVKTLIPLCADTLDPLSDPTDSVNLASGVTSQNAAYVLFTSGSTGE
FT                   PKGTLLEHRAFLSGAMVHGPGLRIYRDSRCLQFAAHTFDASLAETLTPLIHGACVCIPS
FT                   EEARLNDIVSTINEMRVTQACFTPSFIGFIEIESVPGLESLVLAGEAMSQSQLTTWSKI
FT                   KLVNGYGPTEASVASVLNSNVTPDTDCKDIGLPIGVRAWLVNPDNHDELVPVGCPGELL
FT                   LEGPPLARCYVNNPQKTNESFIYDPAWTTLDPETGSNRRFYKTGDLARYNSDTGALNYV
FT                   GRKDTQVKVHGQRIELGEIENQLSKDSNVTHCSVFFPKTGFSKGRLAAVVSSTGLLAEQ
FT                   SDSDLEPLRLVPASKKAELVPGIRERLSARLPTYMVPAVWLCVEALPLLPSGKLDRKGI
FT                   STWVAGMESDPDLQNGTSAAIVDAEASQPANDREEALAAVYSRVLNIPQNQLNLNESFL
FT                   ALGGDSIAAMTCIGLCKKRGFALSVQELLRSKSIRDLATRAKTIDHLTTYEEAVDEPFS
FT                   LSPIQSLHFGVRKEGQGHFNQGILTRLNKPVDERTLRKAVETLVSRHSMLRARFTDTGF
FT                   ATASSQHITRDIKGSYRWRMHTLANMNEVETHVADSQSSINCFSGPLLAVDYFLVKGRP
FT                   NVLSMTAHHLVVDIVSWRIILEDLEDIILNPEKTGTSDGSLPFQTWCRLQNEHCNTLRA
FT                   EHKVATDALAVPDFGYWGLKDTQTTYGDVDCASFEIDPAHTNAILLECHKALGTEPIDL
FT                   FLAAMLHSFGRAFPDRSLPTIYNEGHGREVWDPSIDISHTVGWFTILHPIFVSAYKSDS
FT                   PIDTLIQVKDLRRRVTDNGRADFTSRVLPAQGNQGSKHPHPFEMSFNYVGQHRDLQRKD
FT                   GLFQLVDQMAGEAGQGGGAADFGSDTPRFGLFEISAMVVAGKVRFNFSFNKFMQHQNRI
FT                   HRWVSECQELLVTLSEQLPTLEPRLTLSSFPMLSLTYPTLDKLLNEKLPAMGIESPDFV
FT                   EDIYPCSRMQQGILLGRKRDSSYYAVHDTFEIRATGSGKPNLDRLVNAWQKVVSHHAMF
FT                   RTIFVENLTPRDPFCQVVLKSYDATPVFLQSSGEKDVLATFDKEDPKDYSEPEPAYRFS
FT                   ICQTPTGRLFARIEISHAAMDGNSISIILRDLQLAYAGRLEESPQPLFKDYIQYMQDAP
FT                   NEASISYWRSYLDQAKPCHFPALTDGQQSAKALRSIPVNFGALDELQTVCEKRGITLAN
FT                   VFNAAWGLTLRAFCGSDDVSFSYMASLRDVSADGVQWVVGPVINLLICRMKVADDAKLS
FT                   DVLHQIQNDYMESLPYRHTSLIEIQHALKLSDTNLFNSGVSYRRLPSSKDAVSSEIECA
FT                   EVGSIHDPAEFPVFINIEAMDTTARIDLNYWTTNLSDSQAANVANTYLRCLENVVSNID
FT                   CEIRQLNNLSEDNRAQIMAWNSKTHKPFEKCAHHVVQEMAKKRSDALAVTAWDGNLTYS
FT                   KLDQFSSRLAGYLVTFGVGPGTLIPICFEKSIWNIVSTLAIMKAGGGCIPVDTPESLAA
FT                   VENWIVDNAVQVALASPEKAHVLEDAVPYVIPVSESLLEYLADEDLNPVAQSSDVAYVA
FT                   MTAGTSGPAKSVVLDHSTVMTRAEAFATTMAIADVSRTLQFAPHTSDAFIVEAFATFMW
FT                   GGCICIPADIDPLNLAACINALHVNVASITPTAASFFSPKDVPGLRSIALGGEVVPQSV
FT                   LDHWKTDDLQLQVLYGTCESSAASFHVFCSQEEHEAALIGKSTSCVSWVVDPSNHENLV
FT                   PIGSVGELALEGPVIASGYLDDQSVETSDFFENAPWLSGQRGGRKHRLFKTGDLVRYKS
FT                   DGSLVFVGRKNDKSQSALASELIQTQTRIDTFLEKKKCVVESVQLQRGDMKTNALVAFV
FT                   VFSDTIPVTYGDRVLQSATPGMKDAMSSLHASLSTSLPGSKVPSFYIPISSLPLTVSGK
FT                   LNRQALKFETQALSSSALEAFDIKHWNGSKTGNRAARQASLSGPNIAFWKEYLADVEPC
FT                   IFPALSHEASANARSIRTLNKQSANIHAFSRLSGLPVETLFQFAWAVVLRWYTGSDDVC
FT                   FGYSAAASETKSEADGVSTCRFLVQNEQKLQETLQKAKRDCETSALNVAPLDAVKHQLG
FT                   LDNTTLFNTSLIYRTASNLPKGSTREPSTSSAYKILVEAEVSHSYAEIHFTYSSDTLSS
FT                   FQVSHVMDMFDQVLDDLIAHNLRDRTIGDVNVLPERSVRRIRDWNAASPPRVEKCADEL
FT                   IQQQALLHPRAEAVCSWDKNFTYGQLEIVSSRLARHLSSLGVKPEAFVVLCFEKSAWAV
FT                   VAQLAVLKAGGAFVSIDPSHPDSRLKMLIDEIGTNLVLCSSSVHTKVSKLCTKSFAVCQ
FT                   TSISQLPDSPLALPGARPTPNNAAYAIFTSGTTGKPKATVVEHTALSTTAIAMIDGLHM
FT                   NSTTRALQFSNYTFDVSILEIMMILMTGGCVCIPSEDERMNNLGGAIRRMEATYISAPP
FT                   AIVNTLEPKNVPSLKVIITGGEKMPANHIDRWADRCVINAYGPSEATVVATVGVKVDWD
FT                   GNRVNDDPTSIGTSPNCRVWIVDPNNSNRLLPVGAVGELILEGSNIARGYLANEEKTKA
FT                   SFFENPVWNRHSGLQGVFKRNDRMYRTGDLVRYNSDGSLAFISRKDTQIKFNGQRIELE
FT                   EIEQQCIRCLPEDSQVAVDVVVPEERTIAKGLAAFFTVHDPDSNGGSNDQFAPTVPGAD
FT                   PLLLPISMSNMDAIQKLKGSLPELLPQSMMPRLFFPIRNLPFTSSGKIDRRRLRAMVQT
FT                   LSKDTLKSYITLTTSDRREISSATGLEIKLVALVEKTLELEAGSVTVDDSFFGLGGDSL
FT                   SAMNLVGAAQAEGIALTVSGIFNSPILVDMAKSCVVSDGPAEVKKEDIKAFSLLPSGVY
FT                   LENLMDEVTDSCEVSKDLISDIYPCSAVQEGLLTLSIKHNGAYVAQPSFRLAAGIDVGK
FT                   FKQAWQQTVSDLEILRTRIVHTEAMNFAQVVLKDGPISWVEAESFDSLPNDFLHLPKQN
FT                   GAALTGYAMVHPRGSSDSYFVWSVHHALYDGWSIPLVFRKVEENYFSSQPKRAGTPYSL
FT                   FIDYLAKKDMEESDAFWKSYLTDLSSTPFPHNKNAVPDAMRAGNTQYHNMKLSRTRNSV
FT                   DFTIPVLMRAAWAIVIATHTASGDVCFGETLSGRNIDLPGVADIAGPVLTTVPTRVQVD
FT                   NAMSTMQYLQKIHQSTTEMIPHLHSGLQRIRQLNKDTSEGCNFQNLLVIQPGDGELDNK
FT                   IWIDEKRETSEDFFTHPLVVECGITKTSISFTVHHDELVISGWHTKRLTEQFAHVLQQL
FT                   IALPKNSTSKLEDLEVVSPEDKAEIGTWNERIPLTVERTVQDFIREKSEETPNAQAVCA
FT                   WDGDITYREFWNLASGFANYLVSRGVGPEVFVPVCLDKSAWAMVTLISILIAGGGYVPL
FT                   DPSHPTSRHEEILADVGANMILCTPNYTNRYSRVVKTVIPISKETIKAYGALKSSSRRR
FT                   TDVKPTNMAYALFTSGSTGRAKGIIVEHRNVVSSIMAFAPWVRMDETSRVFQFASLTFD
FT                   AAVMETLAILMLGGTICVPSEDDRLNDVAGAIRRLNVTWTFLTPSIASIIEPSSVPSLK
FT                   HLVCGGEKMSNEVITKWANSVHLMNGYGPTETCVFAVIDNAVATNRDPGRIGYGIPSTL
FT                   TWIVDPDNHDRLTPLGAVGELALEGAPLAREYLKNPEKNAEAFTSDPAWIKDFTPAIPG
FT                   PRRIYKTGDLCYYNPDGSIQYISRKDHQVKLHGQRMELGEIEHRLSEDALTRHAVVVLP
FT                   KNGPLKQRLVTVMSLNSVAADTKLISDKPCELVDENELERHAYNELVEVQKNLENQLPI
FT                   YMVPQTWALIKKLPMLVSGKLDRKKITAWVEDIDDASYERIMADYDRIKRGKIEEKPQE
FT                   KEEKHGSLSIIREIFAQVLNISLQKVNVDRSFVSLGGDSITGMAVISRARKQGLVVTLH
FT                   DILQSRSLKELAQTASSKAPVSQREEKSGDGFALSPVQRLYFQSSDSFKGAARFNQSMT
FT                   VRIARRCEGEVLKRAVKAVIGQHAMFRARFSTSSDGTWQQKTAAVGSLQIPDRTFSNST
FT                   SQEVDESFQFRVHSVADIRGMVPKIAESQNCLDPLNGPILAADLFNLRTGGQVLFLVAH
FT                   HLCIDMVSWRIVLQDLEELVVSGSLSLDKALSFQSWCAMQTERAKIQDATISLPFTPEK
FT                   PSLLYWGMQGSPNVYGDIKMESFMLSEDTTKFILDGCHSVFRTDTVDILLSAIIYSFGR
FT                   TFTDRRVPTIYNEGHGREAWEADIDLSRTVGWFTTMAPLLVDSEARALNDIIKRVKDTR
FT                   RKIADNGRPYFAKNLLQDQGSDFPVPLEILFNYLGKMQQLERADSLFHHHGSVFDSSDF
FT                   AVAGDMGPQTARFALFEVSAIVIKERLNVAFTYNNKMQHQGSIRRWILQCKQTLDKDIL
FT                   TLKTATPEPTLSDYPLLPINYHGLQMLTASTFRKAGIRNKDDVEDIYPCSPMQEGLLLS
FT                   QLRDPNAYMFHTVFEIKDGKSGKVDAEGVARAWQALVDRHPVLRTIFVDSNYTGGSFDQ
FT                   LVLKNLSDNILRVQCQDSQVEEKLAAISLRDRNAMRQAKLSHQLTVCKTNTGRVILKLE
FT                   MNHAIIDGGSVDVLLRDLTLAYERKIAEGSGPLFSDYIKLIRTQSHSDALSHWKEYLGG
FT                   VHPCHLAPSAVFEAKRELKGVKMNFQRFPELLKFCERSSVTLANLTLSAWAIVLRQFVG
FT                   SDDVCFGYLSAGRDAPVDGIQDMVGIFINMLCCRVQFSDQQTLTDVSKSVQDDYIRCIP
FT                   HQSCSLASIQHELGWQGQSLFNTTLSIQNHSVAGGPKDKGLSFDLQHAHDPSEYAVTVN
FT                   VEIARGQEGILLRYWNDIVSDEEAQSLADTIAKVFTGFIESPAATLSQSTFASEAEPES
FT                   VDWDRSQTTLADKAKSTGEAIDSSAMQKIIDDRVHEIIGQMLREGKLTVPPIRTEGLSS
FT                   YGGHTDTIADSPYQLGIQGADDSGVCSATSRSSEDGMSVDVERKLWNLWSTALGLSPNV
FT                   VRHQDSFFKLGGDSITAMKMVSAAREEGLVLTVADVFNNPVFEDMLTTVRAANVTQQML
FT                   NADLKSGGHKEVDSDLLNITPTTLGPSPSTESLEVLKPSCVDDAAVQRGICPKVGVFKG
FT                   GIADVLPVTDFQAMSLTATLFKSRWMLNYFYLEGNGPLDLRRLRESCLKVVAAFDILRT
FT                   VFVCFHDQFFQVVLRKIRPSIFVYETDRALDEFTMTLQQRDREYGPREGEQYVQFYVVK
FT                   KKNSDQHRIMIRLSHTQYDGVCLPKIMAAIKHGYEGTPLPPVTPFAGYLRQLPGTITPD
FT                   HYRHWTDLLKGSHMTQVVRRRGTSMFQNVGAFTEIHRKIEISPTALGNVTIATVMQAAW
FT                   ALALAKLSAQSDVIFGLTISGRNATVPGIESTVGPCVNVIPVRVKFDEKWTGVDLFRYL
FT                   QDQQVSNMPFESLGFREIIKQCTDWPDWTYFTTSVFHQNVDYEGNMQLDNNKYRMGGVG
FT                   VNDNLADLTMVSRPSGERGLDVTLGYSEKGPVMPSFASKVLDMACEIAQSLVANPTASL
FT                   PSASMLRSLPPQTIDDQPRPTDEHFLSAHLKSRSIAELLVHSDILSRSWHQVLPSRTTT
FT                   GPVDPEADKPTHQSAFQLDSSFFDLGGDVFNLAQLTWLLEQEGLKVRLEDLIEHPSFLG
FT                   QMAVLALHNAKHQEDMPTELLATGAAPPDPVARIEKKKTWSKAMTIARKLTGRNTVTSR
FT                   A"
     MAQSTKCYLP RFASTVDGPK RPVSMKTRPT AAQHAQLLTA WNEGRLDPIL RATWALLLHY        60
     YIRSEDICFG YQHLEGDSRS PKSSVQRSTV NISTIRISIN DNDSLKAIVD KVRANSAIRQ       120
     NNGSPEASEA YLPFNTIFML RTYDPPASPS KPILATAIPD ECQVRLHVKV LRGDISIFLE       180
     WRKGDMSGEQ MKSIANIFEQ LLAKVLSAEN TAISQLNLFS ENDWQRIRKW NSTTPQLHDR       240
     CIHEAIHDQM LSGPDREAVC AWDGSLTFAE LDHQASKLAC YLRMQGVGPE IRVALCFDKS       300
     KWNIVAMLGV MKAGGAFVPL DPSHPTSRLQ GLIQSVEAPV VLCSQHLADK LRPIVKTLIP       360
     LCADTLDPLS DPTDSVNLAS GVTSQNAAYV LFTSGSTGEP KGTLLEHRAF LSGAMVHGPG       420
     LRIYRDSRCL QFAAHTFDAS LAETLTPLIH GACVCIPSEE ARLNDIVSTI NEMRVTQACF       480
     TPSFIGFIEI ESVPGLESLV LAGEAMSQSQ LTTWSKIKLV NGYGPTEASV ASVLNSNVTP       540
     DTDCKDIGLP IGVRAWLVNP DNHDELVPVG CPGELLLEGP PLARCYVNNP QKTNESFIYD       600
     PAWTTLDPET GSNRRFYKTG DLARYNSDTG ALNYVGRKDT QVKVHGQRIE LGEIENQLSK       660
     DSNVTHCSVF FPKTGFSKGR LAAVVSSTGL LAEQSDSDLE PLRLVPASKK AELVPGIRER       720
     LSARLPTYMV PAVWLCVEAL PLLPSGKLDR KGISTWVAGM ESDPDLQNGT SAAIVDAEAS       780
     QPANDREEAL AAVYSRVLNI PQNQLNLNES FLALGGDSIA AMTCIGLCKK RGFALSVQEL       840
     LRSKSIRDLA TRAKTIDHLT TYEEAVDEPF SLSPIQSLHF GVRKEGQGHF NQGILTRLNK       900
     PVDERTLRKA VETLVSRHSM LRARFTDTGF ATASSQHITR DIKGSYRWRM HTLANMNEVE       960
     THVADSQSSI NCFSGPLLAV DYFLVKGRPN VLSMTAHHLV VDIVSWRIIL EDLEDIILNP      1020
     EKTGTSDGSL PFQTWCRLQN EHCNTLRAEH KVATDALAVP DFGYWGLKDT QTTYGDVDCA      1080
     SFEIDPAHTN AILLECHKAL GTEPIDLFLA AMLHSFGRAF PDRSLPTIYN EGHGREVWDP      1140
     SIDISHTVGW FTILHPIFVS AYKSDSPIDT LIQVKDLRRR VTDNGRADFT SRVLPAQGNQ      1200
     GSKHPHPFEM SFNYVGQHRD LQRKDGLFQL VDQMAGEAGQ GGGAADFGSD TPRFGLFEIS      1260
     AMVVAGKVRF NFSFNKFMQH QNRIHRWVSE CQELLVTLSE QLPTLEPRLT LSSFPMLSLT      1320
     YPTLDKLLNE KLPAMGIESP DFVEDIYPCS RMQQGILLGR KRDSSYYAVH DTFEIRATGS      1380
     GKPNLDRLVN AWQKVVSHHA MFRTIFVENL TPRDPFCQVV LKSYDATPVF LQSSGEKDVL      1440
     ATFDKEDPKD YSEPEPAYRF SICQTPTGRL FARIEISHAA MDGNSISIIL RDLQLAYAGR      1500
     LEESPQPLFK DYIQYMQDAP NEASISYWRS YLDQAKPCHF PALTDGQQSA KALRSIPVNF      1560
     GALDELQTVC EKRGITLANV FNAAWGLTLR AFCGSDDVSF SYMASLRDVS ADGVQWVVGP      1620
     VINLLICRMK VADDAKLSDV LHQIQNDYME SLPYRHTSLI EIQHALKLSD TNLFNSGVSY      1680
     RRLPSSKDAV SSEIECAEVG SIHDPAEFPV FINIEAMDTT ARIDLNYWTT NLSDSQAANV      1740
     ANTYLRCLEN VVSNIDCEIR QLNNLSEDNR AQIMAWNSKT HKPFEKCAHH VVQEMAKKRS      1800
     DALAVTAWDG NLTYSKLDQF SSRLAGYLVT FGVGPGTLIP ICFEKSIWNI VSTLAIMKAG      1860
     GGCIPVDTPE SLAAVENWIV DNAVQVALAS PEKAHVLEDA VPYVIPVSES LLEYLADEDL      1920
     NPVAQSSDVA YVAMTAGTSG PAKSVVLDHS TVMTRAEAFA TTMAIADVSR TLQFAPHTSD      1980
     AFIVEAFATF MWGGCICIPA DIDPLNLAAC INALHVNVAS ITPTAASFFS PKDVPGLRSI      2040
     ALGGEVVPQS VLDHWKTDDL QLQVLYGTCE SSAASFHVFC SQEEHEAALI GKSTSCVSWV      2100
     VDPSNHENLV PIGSVGELAL EGPVIASGYL DDQSVETSDF FENAPWLSGQ RGGRKHRLFK      2160
     TGDLVRYKSD GSLVFVGRKN DKSQSALASE LIQTQTRIDT FLEKKKCVVE SVQLQRGDMK      2220
     TNALVAFVVF SDTIPVTYGD RVLQSATPGM KDAMSSLHAS LSTSLPGSKV PSFYIPISSL      2280
     PLTVSGKLNR QALKFETQAL SSSALEAFDI KHWNGSKTGN RAARQASLSG PNIAFWKEYL      2340
     ADVEPCIFPA LSHEASANAR SIRTLNKQSA NIHAFSRLSG LPVETLFQFA WAVVLRWYTG      2400
     SDDVCFGYSA AASETKSEAD GVSTCRFLVQ NEQKLQETLQ KAKRDCETSA LNVAPLDAVK      2460
     HQLGLDNTTL FNTSLIYRTA SNLPKGSTRE PSTSSAYKIL VEAEVSHSYA EIHFTYSSDT      2520
     LSSFQVSHVM DMFDQVLDDL IAHNLRDRTI GDVNVLPERS VRRIRDWNAA SPPRVEKCAD      2580
     ELIQQQALLH PRAEAVCSWD KNFTYGQLEI VSSRLARHLS SLGVKPEAFV VLCFEKSAWA      2640
     VVAQLAVLKA GGAFVSIDPS HPDSRLKMLI DEIGTNLVLC SSSVHTKVSK LCTKSFAVCQ      2700
     TSISQLPDSP LALPGARPTP NNAAYAIFTS GTTGKPKATV VEHTALSTTA IAMIDGLHMN      2760
     STTRALQFSN YTFDVSILEI MMILMTGGCV CIPSEDERMN NLGGAIRRME ATYISAPPAI      2820
     VNTLEPKNVP SLKVIITGGE KMPANHIDRW ADRCVINAYG PSEATVVATV GVKVDWDGNR      2880
     VNDDPTSIGT SPNCRVWIVD PNNSNRLLPV GAVGELILEG SNIARGYLAN EEKTKASFFE      2940
     NPVWNRHSGL QGVFKRNDRM YRTGDLVRYN SDGSLAFISR KDTQIKFNGQ RIELEEIEQQ      3000
     CIRCLPEDSQ VAVDVVVPEE RTIAKGLAAF FTVHDPDSNG GSNDQFAPTV PGADPLLLPI      3060
     SMSNMDAIQK LKGSLPELLP QSMMPRLFFP IRNLPFTSSG KIDRRRLRAM VQTLSKDTLK      3120
     SYITLTTSDR REISSATGLE IKLVALVEKT LELEAGSVTV DDSFFGLGGD SLSAMNLVGA      3180
     AQAEGIALTV SGIFNSPILV DMAKSCVVSD GPAEVKKEDI KAFSLLPSGV YLENLMDEVT      3240
     DSCEVSKDLI SDIYPCSAVQ EGLLTLSIKH NGAYVAQPSF RLAAGIDVGK FKQAWQQTVS      3300
     DLEILRTRIV HTEAMNFAQV VLKDGPISWV EAESFDSLPN DFLHLPKQNG AALTGYAMVH      3360
     PRGSSDSYFV WSVHHALYDG WSIPLVFRKV EENYFSSQPK RAGTPYSLFI DYLAKKDMEE      3420
     SDAFWKSYLT DLSSTPFPHN KNAVPDAMRA GNTQYHNMKL SRTRNSVDFT IPVLMRAAWA      3480
     IVIATHTASG DVCFGETLSG RNIDLPGVAD IAGPVLTTVP TRVQVDNAMS TMQYLQKIHQ      3540
     STTEMIPHLH SGLQRIRQLN KDTSEGCNFQ NLLVIQPGDG ELDNKIWIDE KRETSEDFFT      3600
     HPLVVECGIT KTSISFTVHH DELVISGWHT KRLTEQFAHV LQQLIALPKN STSKLEDLEV      3660
     VSPEDKAEIG TWNERIPLTV ERTVQDFIRE KSEETPNAQA VCAWDGDITY REFWNLASGF      3720
     ANYLVSRGVG PEVFVPVCLD KSAWAMVTLI SILIAGGGYV PLDPSHPTSR HEEILADVGA      3780
     NMILCTPNYT NRYSRVVKTV IPISKETIKA YGALKSSSRR RTDVKPTNMA YALFTSGSTG      3840
     RAKGIIVEHR NVVSSIMAFA PWVRMDETSR VFQFASLTFD AAVMETLAIL MLGGTICVPS      3900
     EDDRLNDVAG AIRRLNVTWT FLTPSIASII EPSSVPSLKH LVCGGEKMSN EVITKWANSV      3960
     HLMNGYGPTE TCVFAVIDNA VATNRDPGRI GYGIPSTLTW IVDPDNHDRL TPLGAVGELA      4020
     LEGAPLAREY LKNPEKNAEA FTSDPAWIKD FTPAIPGPRR IYKTGDLCYY NPDGSIQYIS      4080
     RKDHQVKLHG QRMELGEIEH RLSEDALTRH AVVVLPKNGP LKQRLVTVMS LNSVAADTKL      4140
     ISDKPCELVD ENELERHAYN ELVEVQKNLE NQLPIYMVPQ TWALIKKLPM LVSGKLDRKK      4200
     ITAWVEDIDD ASYERIMADY DRIKRGKIEE KPQEKEEKHG SLSIIREIFA QVLNISLQKV      4260
     NVDRSFVSLG GDSITGMAVI SRARKQGLVV TLHDILQSRS LKELAQTASS KAPVSQREEK      4320
     SGDGFALSPV QRLYFQSSDS FKGAARFNQS MTVRIARRCE GEVLKRAVKA VIGQHAMFRA      4380
     RFSTSSDGTW QQKTAAVGSL QIPDRTFSNS TSQEVDESFQ FRVHSVADIR GMVPKIAESQ      4440
     NCLDPLNGPI LAADLFNLRT GGQVLFLVAH HLCIDMVSWR IVLQDLEELV VSGSLSLDKA      4500
     LSFQSWCAMQ TERAKIQDAT ISLPFTPEKP SLLYWGMQGS PNVYGDIKME SFMLSEDTTK      4560
     FILDGCHSVF RTDTVDILLS AIIYSFGRTF TDRRVPTIYN EGHGREAWEA DIDLSRTVGW      4620
     FTTMAPLLVD SEARALNDII KRVKDTRRKI ADNGRPYFAK NLLQDQGSDF PVPLEILFNY      4680
     LGKMQQLERA DSLFHHHGSV FDSSDFAVAG DMGPQTARFA LFEVSAIVIK ERLNVAFTYN      4740
     NKMQHQGSIR RWILQCKQTL DKDILTLKTA TPEPTLSDYP LLPINYHGLQ MLTASTFRKA      4800
     GIRNKDDVED IYPCSPMQEG LLLSQLRDPN AYMFHTVFEI KDGKSGKVDA EGVARAWQAL      4860
     VDRHPVLRTI FVDSNYTGGS FDQLVLKNLS DNILRVQCQD SQVEEKLAAI SLRDRNAMRQ      4920
     AKLSHQLTVC KTNTGRVILK LEMNHAIIDG GSVDVLLRDL TLAYERKIAE GSGPLFSDYI      4980
     KLIRTQSHSD ALSHWKEYLG GVHPCHLAPS AVFEAKRELK GVKMNFQRFP ELLKFCERSS      5040
     VTLANLTLSA WAIVLRQFVG SDDVCFGYLS AGRDAPVDGI QDMVGIFINM LCCRVQFSDQ      5100
     QTLTDVSKSV QDDYIRCIPH QSCSLASIQH ELGWQGQSLF NTTLSIQNHS VAGGPKDKGL      5160
     SFDLQHAHDP SEYAVTVNVE IARGQEGILL RYWNDIVSDE EAQSLADTIA KVFTGFIESP      5220
     AATLSQSTFA SEAEPESVDW DRSQTTLADK AKSTGEAIDS SAMQKIIDDR VHEIIGQMLR      5280
     EGKLTVPPIR TEGLSSYGGH TDTIADSPYQ LGIQGADDSG VCSATSRSSE DGMSVDVERK      5340
     LWNLWSTALG LSPNVVRHQD SFFKLGGDSI TAMKMVSAAR EEGLVLTVAD VFNNPVFEDM      5400
     LTTVRAANVT QQMLNADLKS GGHKEVDSDL LNITPTTLGP SPSTESLEVL KPSCVDDAAV      5460
     QRGICPKVGV FKGGIADVLP VTDFQAMSLT ATLFKSRWML NYFYLEGNGP LDLRRLRESC      5520
     LKVVAAFDIL RTVFVCFHDQ FFQVVLRKIR PSIFVYETDR ALDEFTMTLQ QRDREYGPRE      5580
     GEQYVQFYVV KKKNSDQHRI MIRLSHTQYD GVCLPKIMAA IKHGYEGTPL PPVTPFAGYL      5640
     RQLPGTITPD HYRHWTDLLK GSHMTQVVRR RGTSMFQNVG AFTEIHRKIE ISPTALGNVT      5700
     IATVMQAAWA LALAKLSAQS DVIFGLTISG RNATVPGIES TVGPCVNVIP VRVKFDEKWT      5760
     GVDLFRYLQD QQVSNMPFES LGFREIIKQC TDWPDWTYFT TSVFHQNVDY EGNMQLDNNK      5820
     YRMGGVGVND NLADLTMVSR PSGERGLDVT LGYSEKGPVM PSFASKVLDM ACEIAQSLVA      5880
     NPTASLPSAS MLRSLPPQTI DDQPRPTDEH FLSAHLKSRS IAELLVHSDI LSRSWHQVLP      5940
     SRTTTGPVDP EADKPTHQSA FQLDSSFFDL GGDVFNLAQL TWLLEQEGLK VRLEDLIEHP      6000
     SFLGQMAVLA LHNAKHQEDM PTELLATGAA PPDPVARIEK KKTWSKAMTI ARKLTGRNTV      6060
     TSRA                                                                   6064
//

If you have problems or comments...

PBIL Back to PBIL home page