(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE47

PENCW_13.PE47        Location/Qualifiers
FT   CDS             join(103308..103392,103448..103643,103715..103779,
FT                   103830..104356)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945524"
FT                   /orf_name="Pc16g00470"
FT                   /product="Pc16g00470 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92717.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniParc:UPI0001831157"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V8"
FT                   /transl_table=1
FT                   /translation="MKLTNIALTSAAIGLANAGLVSKRAVSDADILNYALTLEHLEASF
FT                   YEEGLKNFTQEDFVKAGMKDPFYANLKEVASDEKEHVDFLTSALKGMSLCTYNFPSADV
FT                   NGFLALASVLEGVGVSAYLGAAASIMSENYLTAAGSILTTEARHSAYLRAAVGEVPFAQ
FT                   AFDNPLGLNEVYTVASPFIASCPSSNGALPVKAFPALTMSSMDAVMTGSEVQLVAGSGF
FT                   DTSVSGIHAAFITVTGPVWTPLKSMGGGKFTVTIPEGISGQSYVVLTQGNKQATDDNIV
FT                   AGPAIVEVN"
     MKLTNIALTS AAIGLANAGL VSKRAVSDAD ILNYALTLEH LEASFYEEGL KNFTQEDFVK        60
     AGMKDPFYAN LKEVASDEKE HVDFLTSALK GMSLCTYNFP SADVNGFLAL ASVLEGVGVS       120
     AYLGAAASIM SENYLTAAGS ILTTEARHSA YLRAAVGEVP FAQAFDNPLG LNEVYTVASP       180
     FIASCPSSNG ALPVKAFPAL TMSSMDAVMT GSEVQLVAGS GFDTSVSGIH AAFITVTGPV       240
     WTPLKSMGGG KFTVTIPEGI SGQSYVVLTQ GNKQATDDNI VAGPAIVEVN                  290
//

If you have problems or comments...

PBIL Back to PBIL home page