(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE470

PENCW_13.PE470       Location/Qualifiers
FT   CDS             join(complement(1101416..1101744),
FT                   complement(1100854..1101277),complement(1099963..1100808))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824616"
FT                   /orf_name="Pc16g04700"
FT                   /product="Pc16g04700 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93140.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183189A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H900"
FT                   /transl_table=1
FT                   /translation="MVERTEHDYRNSGEIEPHRNGDEIAALEKQSTAASGYSAFEQRTQ
FT                   SIVSRIRSREPGQTAKFHHPLTHTKTSPDVIVDFDGPDDPYRPLNWGFKKKAVTTVLYG
FT                   LTTMGIYSTGQIQISQEFGISNEVATLGTSLLLFGLGLGPLIWAPLSELYGRKTAVLPP
FT                   YFLAAIFSFATATAKDVQTIMITRFFTGFFGSAPVTNTGGVLSDIWSPEERGAAIVGYA
FT                   MAVVGGPVIGPIAGGAIVQSNLGWRWTEYITGIMMMFFLIMDLLFVDESYPPVLLVYKA
FT                   RRLRFESGNWALHARHEEWDVTLKEIGNKYLVRPFQLLATPICFLVALYASFVYGILYL
FT                   SLAAFPIVFQELRGWNQVVGALPFLAYLVGILIGGGINLANQKFYIKRFKANNNRPVPE
FT                   ARLPPMMIGSVLFASGMFVFGWTSPKHIHWICPNIGAVMMGLGFFTIFQAALNYLIDTF
FT                   QKYSASAIAANTFLRSMFAGCFPLFTAAMFHNLGVPWAASVLGFISVALIPIPYLFYKF
FT                   GKRIRARGTWSRDSV"
     MVERTEHDYR NSGEIEPHRN GDEIAALEKQ STAASGYSAF EQRTQSIVSR IRSREPGQTA        60
     KFHHPLTHTK TSPDVIVDFD GPDDPYRPLN WGFKKKAVTT VLYGLTTMGI YSTGQIQISQ       120
     EFGISNEVAT LGTSLLLFGL GLGPLIWAPL SELYGRKTAV LPPYFLAAIF SFATATAKDV       180
     QTIMITRFFT GFFGSAPVTN TGGVLSDIWS PEERGAAIVG YAMAVVGGPV IGPIAGGAIV       240
     QSNLGWRWTE YITGIMMMFF LIMDLLFVDE SYPPVLLVYK ARRLRFESGN WALHARHEEW       300
     DVTLKEIGNK YLVRPFQLLA TPICFLVALY ASFVYGILYL SLAAFPIVFQ ELRGWNQVVG       360
     ALPFLAYLVG ILIGGGINLA NQKFYIKRFK ANNNRPVPEA RLPPMMIGSV LFASGMFVFG       420
     WTSPKHIHWI CPNIGAVMMG LGFFTIFQAA LNYLIDTFQK YSASAIAANT FLRSMFAGCF       480
     PLFTAAMFHN LGVPWAASVL GFISVALIPI PYLFYKFGKR IRARGTWSRD SV               532
//

If you have problems or comments...

PBIL Back to PBIL home page