(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE471

PENCW_13.PE471       Location/Qualifiers
FT   CDS             join(complement(1104725..1104800),
FT                   complement(1104632..1104649),complement(1104489..1104565),
FT                   complement(1104350..1104416),complement(1103272..1104299),
FT                   complement(1102388..1103221))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671908"
FT                   /orf_name="Pc16g04710"
FT                   /product="Pc16g04710 protein"
FT                   /protein_id="CAP93141.1"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="UniParc:UPI000183189B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H901"
FT                   /transl_table=1
FT                   /translation="MLRVGSWLYGKKPAQSVDSQVELKDLHDAMTAATLILNDDVDGAE
FT                   NGLSTGTSSFHNLGKGVVAFVRATLGFEQEIMRQASERLYEAETSAASDQTRSQQNAQA
FT                   PNAFHSDIYAAGTEYALCQAIAQLMNAVVGVLNESLTESIKAFYRLRKAYIALDAIMKM
FT                   EEKFMEQRDIHKGILPTTSDLSCSESSSLSSKKGTKGATVDQTELSSSMNGLAISSRGA
FT                   SPDASTGTSTPAKHIHHDPDSDIFKNEIDVFVHSGANFCFGILLLLISMVPPAFSKLLS
FT                   IIGFHGDKQRGLKMLWQASKFHNLIGAMAALALLGYYNGFVRYCDIMPDPTPGEADVEG
FT                   YPQERLAALLAEMRSRFPNSQLWLLEESRMLGANKDLDSALDLLSTGKRSPLKQVEGLC
FT                   VFEKGLNALFLHRYDVCAEVFIECVDLNSWSRSLYYYIAGACHVVQYRQSLNDPKLAEE
FT                   HAKKATLYLRKAPEFAGKKKFMARQLPFDIFVTRKLAKWEARAKEWNVSLVDAIGVDPV
FT                   EEMIFFWNGHSRMTNEQLQESLTRLEWCESENNKTWSREGIEEKAILELLRAAVLRSLY
FT                   RHDEAKKILQTRVLNHDKSVFKGHLKDDWVHPAAHFEMAANFWMERPAYQVLHGIASPK
FT                   VSNEASAESGETNTESERKQVSECKEYLEHAARWESYELDARIGLKVTAAMEAVHKWEN
FT                   MHPTV"
     MLRVGSWLYG KKPAQSVDSQ VELKDLHDAM TAATLILNDD VDGAENGLST GTSSFHNLGK        60
     GVVAFVRATL GFEQEIMRQA SERLYEAETS AASDQTRSQQ NAQAPNAFHS DIYAAGTEYA       120
     LCQAIAQLMN AVVGVLNESL TESIKAFYRL RKAYIALDAI MKMEEKFMEQ RDIHKGILPT       180
     TSDLSCSESS SLSSKKGTKG ATVDQTELSS SMNGLAISSR GASPDASTGT STPAKHIHHD       240
     PDSDIFKNEI DVFVHSGANF CFGILLLLIS MVPPAFSKLL SIIGFHGDKQ RGLKMLWQAS       300
     KFHNLIGAMA ALALLGYYNG FVRYCDIMPD PTPGEADVEG YPQERLAALL AEMRSRFPNS       360
     QLWLLEESRM LGANKDLDSA LDLLSTGKRS PLKQVEGLCV FEKGLNALFL HRYDVCAEVF       420
     IECVDLNSWS RSLYYYIAGA CHVVQYRQSL NDPKLAEEHA KKATLYLRKA PEFAGKKKFM       480
     ARQLPFDIFV TRKLAKWEAR AKEWNVSLVD AIGVDPVEEM IFFWNGHSRM TNEQLQESLT       540
     RLEWCESENN KTWSREGIEE KAILELLRAA VLRSLYRHDE AKKILQTRVL NHDKSVFKGH       600
     LKDDWVHPAA HFEMAANFWM ERPAYQVLHG IASPKVSNEA SAESGETNTE SERKQVSECK       660
     EYLEHAARWE SYELDARIGL KVTAAMEAVH KWENMHPTV                              699
//

If you have problems or comments...

PBIL Back to PBIL home page