(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE473

PENCW_13.PE473       Location/Qualifiers
FT   CDS             join(complement(1107942..1108007),
FT                   complement(1107466..1107886),complement(1106637..1107403))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128960"
FT                   /gene_name="pgkA"
FT                   /orf_name="Pc16g04730"
FT                   /product="Phosphoglycerate kinase pgkA-Penicillium
FT                   chrysogenum"
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP93143.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI000183189D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H903"
FT                   /transl_table=1
FT                   /translation="MSLSNKLPVTDVDLKGKRVLIRVDFNVPLDENKNVTNPQRIVGAL
FT                   PTIKYAIDNGAKAVVLMSHLGRPDGKVNPKYSLKPVVPVLEELLGKSVTFTEDCVGPQT
FT                   EETVNKASDGQVILLENLRFHAEEEGSSKDAEGKKVKADKADVDAFRKGLTALGDVYVN
FT                   DAFGTAHRAHSSMVGVDLPQKAAGFLVKKELEYFAKALESPARPFLAILGGAKVSDKIQ
FT                   LIDNLLPKVNSLIITGGMAFTFKKTLENVKIGNSLFDEAGSKIVGEIVEKAKKHNVEIV
FT                   LPVDYVTADKFSADATVGAATDASGIPDGYMGLDVGPESVKLYQKTIAEAKTILWNGPP
FT                   GVFELKPFAKATEATLDAAVKAAESGSIVIIGGGDTATVAAKYKAEDKISHVSTGGGAS
FT                   LELLEGKELPGVAALSSK"
     MSLSNKLPVT DVDLKGKRVL IRVDFNVPLD ENKNVTNPQR IVGALPTIKY AIDNGAKAVV        60
     LMSHLGRPDG KVNPKYSLKP VVPVLEELLG KSVTFTEDCV GPQTEETVNK ASDGQVILLE       120
     NLRFHAEEEG SSKDAEGKKV KADKADVDAF RKGLTALGDV YVNDAFGTAH RAHSSMVGVD       180
     LPQKAAGFLV KKELEYFAKA LESPARPFLA ILGGAKVSDK IQLIDNLLPK VNSLIITGGM       240
     AFTFKKTLEN VKIGNSLFDE AGSKIVGEIV EKAKKHNVEI VLPVDYVTAD KFSADATVGA       300
     ATDASGIPDG YMGLDVGPES VKLYQKTIAE AKTILWNGPP GVFELKPFAK ATEATLDAAV       360
     KAAESGSIVI IGGGDTATVA AKYKAEDKIS HVSTGGGASL ELLEGKELPG VAALSSK          417
//

If you have problems or comments...

PBIL Back to PBIL home page