(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE474

PENCW_13.PE474       Location/Qualifiers
FT   CDS             join(complement(1109614..1109671),
FT                   complement(1109529..1109554),complement(1109127..1109463),
FT                   complement(1108903..1109069),complement(1108778..1108849))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948788"
FT                   /orf_name="Pc16g04740"
FT                   /product="Pc16g04740 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93144.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000183189E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H950"
FT                   /transl_table=1
FT                   /translation="MAVAARLAAKFNTYYAERPVLTTMVTNAVLGGVADTVAQLITAFR
FT                   TRRPPTSGDDFLSIEIPDLDKQKPPAVGELGYVRSSSPPFDFERLTRFMAYGFFMAPVQ
FT                   FQWFGFLSRAFPLTKKNPTAPAFKRVAFDQFIFAPFGLACFFTYMTIAEGGGRRALTHK
FT                   FRDVYLPTLKANFVLWPAVQILNFRVIPIQFQIPFVSTVGIAWTAYLSLTNSAEEV"
     MAVAARLAAK FNTYYAERPV LTTMVTNAVL GGVADTVAQL ITAFRTRRPP TSGDDFLSIE        60
     IPDLDKQKPP AVGELGYVRS SSPPFDFERL TRFMAYGFFM APVQFQWFGF LSRAFPLTKK       120
     NPTAPAFKRV AFDQFIFAPF GLACFFTYMT IAEGGGRRAL THKFRDVYLP TLKANFVLWP       180
     AVQILNFRVI PIQFQIPFVS TVGIAWTAYL SLTNSAEEV                              219
//

If you have problems or comments...

PBIL Back to PBIL home page