(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE475

PENCW_13.PE475       Location/Qualifiers
FT   CDS             join(1110839..1110923,1111159..1111273,1111340..1111613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948789"
FT                   /orf_name="Pc16g04750"
FT                   /product="Putative uncharacterized protein Pc16g04750 "
FT                   /protein_id="CAP93145.1"
FT                   /db_xref="UniParc:UPI000183189F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H951"
FT                   /transl_table=1
FT                   /translation="MDEWNAPPLLTTAALQGWSERKTMFRTSGSQKRNEAQIVAKLKMC
FT                   LADLYDGHDVIPAKPSCGRTLAMSLGEKYSGGTPEETADYLPEDQTKCKYSLAARRNEV
FT                   SNVLSSLLADSQLKQKHILDTQVQGYRQCHRGGHAGPLTVGRWLTSAHRLLQL"
     MDEWNAPPLL TTAALQGWSE RKTMFRTSGS QKRNEAQIVA KLKMCLADLY DGHDVIPAKP        60
     SCGRTLAMSL GEKYSGGTPE ETADYLPEDQ TKCKYSLAAR RNEVSNVLSS LLADSQLKQK       120
     HILDTQVQGY RQCHRGGHAG PLTVGRWLTS AHRLLQL                                157
//

If you have problems or comments...

PBIL Back to PBIL home page