(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE476

PENCW_13.PE476       Location/Qualifiers
FT   CDS             join(complement(1113905..1114079),
FT                   complement(1113576..1113848),complement(1112404..1113514),
FT                   complement(1112176..1112344))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207885" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948790"
FT                   /orf_name="Pc16g04760"
FT                   /product="Pc16g04760 protein"
FT                   /protein_id="CAP93146.1"
FT                   /db_xref="UniParc:UPI00018318A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H952"
FT                   /transl_table=1
FT                   /translation="MPGLEIPGEFLRHAILDTFVPHSPALDIEGALSSSLENGADDLPS
FT                   VLSSIPQRSLLFFDEFLPVRIVLRLSDCSETILKHYLPRLEVKLDVFAVDPAESVGENL
FT                   TPTRDIIFSGIVSGDEDPLVVFNEFEGDEGSGNHVYLVWNIETILRRPRIRIQHPSLLF
FT                   IASTSLNPADARRQEDSEDDYLPSLVPASTNMLQSLSIDKSFNHKEPFLPASRLLRVVP
FT                   TTYNEDPIYNIQQHHGHPFRVVPAASARIRYSRLNSYTGTPMTVASLDFEVTPYLTCEV
FT                   AFDKANLHLSEGTIESLSETPGLALPITCRPRDDVTLMYKLTPEYGPETNPSSTALVSM
FT                   LDIALEAIILVDDECKPRISMQWRTNVDFSVALNPTFGGPSPALQRTNRPTSLSVSTQG
FT                   GVTPSNRSSLRERAYSVTDVGITISFSGPVRVQVGSVFSWDVFIVNRSNVPRKFALIAI
FT                   PKRKRVDPRGHVARPSSSSITSRKEDQVAEAVTDDNIVHARQKSVAGQEVELISLSTDI
FT                   RVGPLLPGTCHSTELKLLPLATGPLHLEAVRLVDVNTNETTDIRDLPDILADDQPRSS"
     MPGLEIPGEF LRHAILDTFV PHSPALDIEG ALSSSLENGA DDLPSVLSSI PQRSLLFFDE        60
     FLPVRIVLRL SDCSETILKH YLPRLEVKLD VFAVDPAESV GENLTPTRDI IFSGIVSGDE       120
     DPLVVFNEFE GDEGSGNHVY LVWNIETILR RPRIRIQHPS LLFIASTSLN PADARRQEDS       180
     EDDYLPSLVP ASTNMLQSLS IDKSFNHKEP FLPASRLLRV VPTTYNEDPI YNIQQHHGHP       240
     FRVVPAASAR IRYSRLNSYT GTPMTVASLD FEVTPYLTCE VAFDKANLHL SEGTIESLSE       300
     TPGLALPITC RPRDDVTLMY KLTPEYGPET NPSSTALVSM LDIALEAIIL VDDECKPRIS       360
     MQWRTNVDFS VALNPTFGGP SPALQRTNRP TSLSVSTQGG VTPSNRSSLR ERAYSVTDVG       420
     ITISFSGPVR VQVGSVFSWD VFIVNRSNVP RKFALIAIPK RKRVDPRGHV ARPSSSSITS       480
     RKEDQVAEAV TDDNIVHARQ KSVAGQEVEL ISLSTDIRVG PLLPGTCHST ELKLLPLATG       540
     PLHLEAVRLV DVNTNETTDI RDLPDILADD QPRSS                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page