(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE477

PENCW_13.PE477       Location/Qualifiers
FT   CDS             join(1114252..1114386,1114436..1114587,1114636..1114709,
FT                   1114782..1115752,1115812..1116798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128961"
FT                   /orf_name="Pc16g04770"
FT                   /product="Pc16g04770 protein"
FT                   /protein_id="CAP93147.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="UniParc:UPI00018318A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H953"
FT                   /transl_table=1
FT                   /translation="MDLSINPGAALWQQAQNAEGRVYYYNVQTKATQWTKPQELMTPVE
FT                   LALANQPWREHTTDAGRKYWYHTETKQSTWEMPEVYKNALAQAPAPLAPPATPSFVAGG
FT                   TSFPQPQQRDREDFDRGYGDRRGGYAPYEANGLVAAPEFKTMDPDYHSLEEAESAFMKL
FT                   LKRHNVQPDWTWEETMRATIKDPQYRALKDPRDRKAAFEKYVVEVRAQEKDRAKERFAK
FT                   LRADFNTMLKRHPEIKYYSRWKTIRPIIEGETTFRSTNEESERRQLFDEYILELKKAHL
FT                   EQESVTHKAAMDELMNILGSLNLEPYTRWSEAHAIIQSDSKFQGDDKFKTLSKSDILIA
FT                   FENHIKSLERAFNDARQQHKAARARKERKNREQFVALLKELRSQGKIKAGAKWMNICPI
FT                   IKDDPRYHGILGQSGSTPLDLFWDMVEEEERALRGPRNDVLDVLDDKRYEVTPETTFDE
FT                   FNSIMSADRRTSKIDPDILNLIFQRIQEKAIRRTEDEKHAADRQQRRAVDALRSRIKRL
FT                   EPPIRVTDTWAEVQPRLEKYDEYKALESDELRESAFEKAIRRLKERDEDAEREREALSQ
FT                   SRGGRRDFDRGDRDYRSGRGERRGHRTPEMDAYEADRRKAQADRERTYRKVSGISPSRD
FT                   RRDERGDRDRYRSRDRDFDRPRVRDPDRREDERERLYRTRGDPRGGRDELDYGGGTVGD
FT                   TRSVASGDRRRRRDSDTESVASRSAKRYRRDSRERERSKGPRAPRRERSAIPEEENEDA
FT                   KKDEKAIHSGSEEGEIEEE"
     MDLSINPGAA LWQQAQNAEG RVYYYNVQTK ATQWTKPQEL MTPVELALAN QPWREHTTDA        60
     GRKYWYHTET KQSTWEMPEV YKNALAQAPA PLAPPATPSF VAGGTSFPQP QQRDREDFDR       120
     GYGDRRGGYA PYEANGLVAA PEFKTMDPDY HSLEEAESAF MKLLKRHNVQ PDWTWEETMR       180
     ATIKDPQYRA LKDPRDRKAA FEKYVVEVRA QEKDRAKERF AKLRADFNTM LKRHPEIKYY       240
     SRWKTIRPII EGETTFRSTN EESERRQLFD EYILELKKAH LEQESVTHKA AMDELMNILG       300
     SLNLEPYTRW SEAHAIIQSD SKFQGDDKFK TLSKSDILIA FENHIKSLER AFNDARQQHK       360
     AARARKERKN REQFVALLKE LRSQGKIKAG AKWMNICPII KDDPRYHGIL GQSGSTPLDL       420
     FWDMVEEEER ALRGPRNDVL DVLDDKRYEV TPETTFDEFN SIMSADRRTS KIDPDILNLI       480
     FQRIQEKAIR RTEDEKHAAD RQQRRAVDAL RSRIKRLEPP IRVTDTWAEV QPRLEKYDEY       540
     KALESDELRE SAFEKAIRRL KERDEDAERE REALSQSRGG RRDFDRGDRD YRSGRGERRG       600
     HRTPEMDAYE ADRRKAQADR ERTYRKVSGI SPSRDRRDER GDRDRYRSRD RDFDRPRVRD       660
     PDRREDERER LYRTRGDPRG GRDELDYGGG TVGDTRSVAS GDRRRRRDSD TESVASRSAK       720
     RYRRDSRERE RSKGPRAPRR ERSAIPEEEN EDAKKDEKAI HSGSEEGEIE EE               772
//

If you have problems or comments...

PBIL Back to PBIL home page