(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE478

PENCW_13.PE478       Location/Qualifiers
FT   CDS             join(complement(1118677..1119224),
FT                   complement(1117553..1118618))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128962"
FT                   /orf_name="Pc16g04780"
FT                   /product="Pc16g04780 protein"
FT                   /protein_id="CAP93148.1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniParc:UPI000183196C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H954"
FT                   /transl_table=1
FT                   /translation="MSQPQFADRGTTQDTEAWIFGSGSEALASAVYLIKDAKVHPPKIH
FT                   IIDKHLFSERISHRPGSWSDGYDQFAACLPVPAGLPMERLLATLPSTQSQGPSLLEEIQ
FT                   TAEANRVPKKRDVRTCFLAMTKGSVNHIPTDSLNLSIKHRIALIQILFKRETYLSQRQV
FT                   QELLPENFFQSPFWTIWSAQFGFQPWHSAAEFRRSIRQYMPQFHSLSILSCLDITGYYQ
FT                   YESLYSPIYRFLESCGVDFRFGVEVKDIQVSKDDAKPKVTGFNLVKGKQQLRKQLGEND
FT                   IVIMNIGSTISGSAVGTNNSSPVWQSLDADDLFDQNWSVWLDLGNKHNGLGNPYNFCTR
FT                   QSETMVESFTITTQDLVLYDDLRSLIKCRSEAGAFIFLGDSNWKINLCIPAQPVFSSQP
FT                   EDVRVLWGFAHAPRVEGNYVNRILLHCSGADILSEILGHLNLHYNPPLSRTVTIPRAMP
FT                   RMSSLFITRALNDRPSITPLSNVGLVGPFTESSGYTCSDVSYGIRTAKTAVYKLMGLKG
FT                   ELDGPLYSNTSIIRKILFWR"
     MSQPQFADRG TTQDTEAWIF GSGSEALASA VYLIKDAKVH PPKIHIIDKH LFSERISHRP        60
     GSWSDGYDQF AACLPVPAGL PMERLLATLP STQSQGPSLL EEIQTAEANR VPKKRDVRTC       120
     FLAMTKGSVN HIPTDSLNLS IKHRIALIQI LFKRETYLSQ RQVQELLPEN FFQSPFWTIW       180
     SAQFGFQPWH SAAEFRRSIR QYMPQFHSLS ILSCLDITGY YQYESLYSPI YRFLESCGVD       240
     FRFGVEVKDI QVSKDDAKPK VTGFNLVKGK QQLRKQLGEN DIVIMNIGST ISGSAVGTNN       300
     SSPVWQSLDA DDLFDQNWSV WLDLGNKHNG LGNPYNFCTR QSETMVESFT ITTQDLVLYD       360
     DLRSLIKCRS EAGAFIFLGD SNWKINLCIP AQPVFSSQPE DVRVLWGFAH APRVEGNYVN       420
     RILLHCSGAD ILSEILGHLN LHYNPPLSRT VTIPRAMPRM SSLFITRALN DRPSITPLSN       480
     VGLVGPFTES SGYTCSDVSY GIRTAKTAVY KLMGLKGELD GPLYSNTSII RKILFWR          537
//

If you have problems or comments...

PBIL Back to PBIL home page