(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE480

PENCW_13.PE480       Location/Qualifiers
FT   CDS             join(complement(1124740..1124759),
FT                   complement(1124654..1124678),complement(1124557..1124568),
FT                   complement(1124100..1124502),complement(1123882..1124043),
FT                   complement(1123733..1123829),complement(1122242..1123670))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000222803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128963"
FT                   /orf_name="Pc16g04800"
FT                   /product="Pc16g04800 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAP93150.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI000183196E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H956"
FT                   /transl_table=1
FT                   /translation="MSDKLTRIAIINSDKCKPKKCRQECKKSCPVVRTGKLCIEVDPSS
FT                   KIAFISERLCIGCGICPKKCPFGAIHIINLPTNLETQVTHRYSANSFKLHRLPMPRPGQ
FT                   VLGLVGTNGIGKSTALKILSGKLKPNLGRYDNPPDWEEILKYFRGSDLQNYFTKILEDD
FT                   LKAVVKPQYVDQIPRAVKGPVQQVQQLISARAALGNEQEIMDVLELNQVAQRDIGHLSG
FT                   GELQRFAIGLVCVQKADVYMFDEPSSYLDVKQRLAAARTIRSLLRPDDYVIVVEHDLSV
FT                   LDYLSDFICVLYGRPAVYGVVTLPSSVREGINIFLDGHIPTENLRFREESLTFRLAEAG
FT                   EEFVADKDRAFAYPTMEKTLGDFHLKVEAGKFTDSEIVVMMGENGTGKTTFCKMLAGAL
FT                   KPDGLISVPKMNISMKPQKITPKFTGTVRQLFFKRIKTAFLSPQFQTDVYKPLKMDDFI
FT                   DQEVQNLSGGELQRVAIVLALGMPADIYLIDEPSAYLDSEQRIVAARVIKRFIMHTKKT
FT                   AFIVEHDFIMATYLADRVIVFDGQPSVSARAQTPESLVGGCNRFLKSLDVTFRRDPTSY
FT                   RPRINKYNSQMDQEQKLAGNFVSFLPYPWMLRIPLINPVLTIFNSTSWKKRTEKGVHNE
FT                   HRRRRHKRDGRDYEQRRNRHRGDWKIVWLMGFLGVYRASGVQGEGFRHRAGSSSGADDG
FT                   LSDDDGDDDDDDDLNGNSDPD"
     MSDKLTRIAI INSDKCKPKK CRQECKKSCP VVRTGKLCIE VDPSSKIAFI SERLCIGCGI        60
     CPKKCPFGAI HIINLPTNLE TQVTHRYSAN SFKLHRLPMP RPGQVLGLVG TNGIGKSTAL       120
     KILSGKLKPN LGRYDNPPDW EEILKYFRGS DLQNYFTKIL EDDLKAVVKP QYVDQIPRAV       180
     KGPVQQVQQL ISARAALGNE QEIMDVLELN QVAQRDIGHL SGGELQRFAI GLVCVQKADV       240
     YMFDEPSSYL DVKQRLAAAR TIRSLLRPDD YVIVVEHDLS VLDYLSDFIC VLYGRPAVYG       300
     VVTLPSSVRE GINIFLDGHI PTENLRFREE SLTFRLAEAG EEFVADKDRA FAYPTMEKTL       360
     GDFHLKVEAG KFTDSEIVVM MGENGTGKTT FCKMLAGALK PDGLISVPKM NISMKPQKIT       420
     PKFTGTVRQL FFKRIKTAFL SPQFQTDVYK PLKMDDFIDQ EVQNLSGGEL QRVAIVLALG       480
     MPADIYLIDE PSAYLDSEQR IVAARVIKRF IMHTKKTAFI VEHDFIMATY LADRVIVFDG       540
     QPSVSARAQT PESLVGGCNR FLKSLDVTFR RDPTSYRPRI NKYNSQMDQE QKLAGNFVSF       600
     LPYPWMLRIP LINPVLTIFN STSWKKRTEK GVHNEHRRRR HKRDGRDYEQ RRNRHRGDWK       660
     IVWLMGFLGV YRASGVQGEG FRHRAGSSSG ADDGLSDDDG DDDDDDDLNG NSDPD            715
//

If you have problems or comments...

PBIL Back to PBIL home page