(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE483

PENCW_13.PE483       Location/Qualifiers
FT   CDS             join(complement(1134691..1134742),
FT                   complement(1134206..1134638),complement(1133651..1134131))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948792"
FT                   /orf_name="Pc16g04830"
FT                   /product="Pc16g04830 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93153.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0001831971"
FT                   /db_xref="UniProtKB/TrEMBL:B6H994"
FT                   /transl_table=1
FT                   /translation="MPSLIGKEIGPIGYGTMRMTWNAQPPSEEVCFETLNTTLELGANF
FT                   WNGGELYGTPEYNSLHLLNKYFTKYPGNADKVVLSVKGGLKKGELTPDGSEENIRRSVD
FT                   ECLRLLDGKKKLDIFECARQDPAFPVEQTIKVLAEYVKEGKIGGIGLSEVDAETIRRAH
FT                   KVHPIAAVEIEMSLWSTDILHNDIAKTCAELQIPVIAYSPLGRGVLTGAVTSLADIPAG
FT                   DIRHHLSRFQEENFKHNMKLINEVNDLATRKGVASAQIALAWILTQSKKPGMPTIIPIP
FT                   GGTTKDKVVQNMGGAQALTDSEMAEIEAILEEHTVSGARY"
     MPSLIGKEIG PIGYGTMRMT WNAQPPSEEV CFETLNTTLE LGANFWNGGE LYGTPEYNSL        60
     HLLNKYFTKY PGNADKVVLS VKGGLKKGEL TPDGSEENIR RSVDECLRLL DGKKKLDIFE       120
     CARQDPAFPV EQTIKVLAEY VKEGKIGGIG LSEVDAETIR RAHKVHPIAA VEIEMSLWST       180
     DILHNDIAKT CAELQIPVIA YSPLGRGVLT GAVTSLADIP AGDIRHHLSR FQEENFKHNM       240
     KLINEVNDLA TRKGVASAQI ALAWILTQSK KPGMPTIIPI PGGTTKDKVV QNMGGAQALT       300
     DSEMAEIEAI LEEHTVSGAR Y                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page