(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE484

PENCW_13.PE484       Location/Qualifiers
FT   CDS             join(complement(1135984..1136127),
FT                   complement(1135480..1135923))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671910"
FT                   /orf_name="Pc16g04840"
FT                   /product="Putative uncharacterized protein Pc16g04840 "
FT                   /protein_id="CAP93154.1"
FT                   /db_xref="UniParc:UPI0001831972"
FT                   /db_xref="UniProtKB/TrEMBL:B6H995"
FT                   /transl_table=1
FT                   /translation="MSHVTSRASWLSLLLVSLLVVSTVNALPIYQTDQQIEGQVGKLES
FT                   RSPRLIPDTAEYVHDILQGLGLTKPSPSSTATSSATPTSTPTSTPTASIKDEQDVEYMK
FT                   PTHTTHIIYSSSTSYTPTHGSNGAGYTHTVKQEHSNNRPVENIQIGQGWNGGKKITAEN
FT                   FPAVFDAVYKELEHRLSDAINSSDEIGLENFL"
     MSHVTSRASW LSLLLVSLLV VSTVNALPIY QTDQQIEGQV GKLESRSPRL IPDTAEYVHD        60
     ILQGLGLTKP SPSSTATSSA TPTSTPTSTP TASIKDEQDV EYMKPTHTTH IIYSSSTSYT       120
     PTHGSNGAGY THTVKQEHSN NRPVENIQIG QGWNGGKKIT AENFPAVFDA VYKELEHRLS       180
     DAINSSDEIG LENFL                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page