(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE485

PENCW_13.PE485       Location/Qualifiers
FT   CDS             join(complement(1137411..1138038),
FT                   complement(1137123..1137337),complement(1136980..1137072),
FT                   complement(1136868..1136906))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948793"
FT                   /orf_name="Pc16g04850"
FT                   /product="Pc16g04850 protein"
FT                   /protein_id="CAP93155.1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI0001831973"
FT                   /db_xref="UniProtKB/TrEMBL:B6H996"
FT                   /transl_table=1
FT                   /translation="MVGVQVDNLAVNDGPLTSENATLLRPSDPTLPLEELRKRYDEDGY
FT                   LLLKGVLPREDVLAARDAYFSSLESTGVLKPGTTPVEGVFDPAKDHLDYPGIGAGHIGG
FT                   NGKPGGERAAAFVDLALDAHYQDWYANKFCNHPALYDFIARFSDWGKNTLSMRRTLLRN
FT                   NLPKSKPIGVHYDQIFLRYGDPTSITAWVPMGDIKLNGGGLIYLENGDKVGIEMEEAFF
FT                   TKAKQAGLTDEEAKSAFNSNMMSTGLLSEFPTDFAREHGQRWMVSAYEAGDVVLHKPHM
FT                   IHASTVNNDPDNVIRLATDLRFCDSSKPYDKRWMNHYTFNDGV"
     MVGVQVDNLA VNDGPLTSEN ATLLRPSDPT LPLEELRKRY DEDGYLLLKG VLPREDVLAA        60
     RDAYFSSLES TGVLKPGTTP VEGVFDPAKD HLDYPGIGAG HIGGNGKPGG ERAAAFVDLA       120
     LDAHYQDWYA NKFCNHPALY DFIARFSDWG KNTLSMRRTL LRNNLPKSKP IGVHYDQIFL       180
     RYGDPTSITA WVPMGDIKLN GGGLIYLENG DKVGIEMEEA FFTKAKQAGL TDEEAKSAFN       240
     SNMMSTGLLS EFPTDFAREH GQRWMVSAYE AGDVVLHKPH MIHASTVNND PDNVIRLATD       300
     LRFCDSSKPY DKRWMNHYTF NDGV                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page