(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE487

PENCW_13.PE487       Location/Qualifiers
FT   CDS             join(complement(1142250..1143278),
FT                   complement(1141465..1142154))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000235013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824617"
FT                   /orf_name="Pc16g04870"
FT                   /product="Pc16g04870 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAP93157.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI0001831974"
FT                   /db_xref="UniProtKB/TrEMBL:B6H997"
FT                   /transl_table=1
FT                   /translation="MSRLEIALSSTPEHLLKHLLLGTVLLTSLYALYRRLLPKPLPGIP
FT                   FNQKSAQSIWGDVLELRDDPSGLAKWCSKQLENHGSPICQALMGPLSKPVVLVADVGNA
FT                   REMLMGRSDFDRSAYIIDRFPLFGEFHLNMKTGDNWRQSRNWLKDLLAPQYLHNVAGPA
FT                   IHSSVLKLIELWQHKFHVGDGRVFSMVSDLKTLALDVIVAFHFGSDFQDSALDRQIDHV
FT                   GKLDGSKLPSGEYNEVEFSKAPLHEFQQGLTDVGDKMAAIYTTKWPPLLVAWWVRYVSP
FT                   YYRPFFEAKDRFIRKHINLAVRRCRSDEDPSTGIDYMVHREEKAARKARREPVFDKQIM
FT                   VDEAYGNLIAGQHTTSAALVWILKLLADYPSVQEKLREELQGIFDSAMQENRLPTAAEI
FT                   IKSKLPYLDAVLEETLRLRAAMLVPRDAAKDTELLGHRIPKGTVVLLVCQGPDYKPSPP
FT                   SKYWSDVKASRMYPGKGNPDLEIFDPERWLVRNEKGDLEFDGSSYPQLAFGLGIRSCWG
FT                   RRLAMVEMRIMTTLMILKFELKDVPKGLRGHEASYDISYRAKKGFLHLKSRGEFP"
     MSRLEIALSS TPEHLLKHLL LGTVLLTSLY ALYRRLLPKP LPGIPFNQKS AQSIWGDVLE        60
     LRDDPSGLAK WCSKQLENHG SPICQALMGP LSKPVVLVAD VGNAREMLMG RSDFDRSAYI       120
     IDRFPLFGEF HLNMKTGDNW RQSRNWLKDL LAPQYLHNVA GPAIHSSVLK LIELWQHKFH       180
     VGDGRVFSMV SDLKTLALDV IVAFHFGSDF QDSALDRQID HVGKLDGSKL PSGEYNEVEF       240
     SKAPLHEFQQ GLTDVGDKMA AIYTTKWPPL LVAWWVRYVS PYYRPFFEAK DRFIRKHINL       300
     AVRRCRSDED PSTGIDYMVH REEKAARKAR REPVFDKQIM VDEAYGNLIA GQHTTSAALV       360
     WILKLLADYP SVQEKLREEL QGIFDSAMQE NRLPTAAEII KSKLPYLDAV LEETLRLRAA       420
     MLVPRDAAKD TELLGHRIPK GTVVLLVCQG PDYKPSPPSK YWSDVKASRM YPGKGNPDLE       480
     IFDPERWLVR NEKGDLEFDG SSYPQLAFGL GIRSCWGRRL AMVEMRIMTT LMILKFELKD       540
     VPKGLRGHEA SYDISYRAKK GFLHLKSRGE FP                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page