(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE488

PENCW_13.PE488       Location/Qualifiers
FT   CDS             join(complement(1146249..1146329),
FT                   complement(1145944..1146216),complement(1145743..1145885),
FT                   complement(1145168..1145653),complement(1144081..1145113))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235014" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948794"
FT                   /orf_name="Pc16g04880"
FT                   /product="Pc16g04880 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93158.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831975"
FT                   /db_xref="UniProtKB/TrEMBL:B6H998"
FT                   /transl_table=1
FT                   /translation="MQGQKRRVRTCHSCYTRKQKASESDSICDRQYPCNHCTRRRRPEE
FT                   CVYGPPPVKVPSCPPVPADQSETQPRPVESARPTRETPVDDSEAHWSREHSALARSFGY
FT                   FEDSNSNTMALLRRLELPDQSDTELKNAWPSTWETIHHELDLMPERQIIDFLVQYFVYE
FT                   LNWMKQVIHVPSFLANYQLWWAKDKIVEIADVEFAALIARICSYATQFLPSPSHTVDQI
FT                   RGRSLADIRDTCSNIGNKLATACETLDWKGTLVRVQHIIFAALKVSCEGRTSQFWEGIG
FT                   SACRAAQKAGIHTDTTGLESQLAKDSAQELERDVQRRTFCSLYVLDSHLSRQLDRIPFL
FT                   SNHLIEETLPRLRLIPDIGNIPTETATRAPDIFTERLMQVQLGLFWRGLGLQRTCEFDP
FT                   TESERIYEKFNSEYLNNLHPAFAIAHPDTTLDKALPKLPMQRQLLYIAIFDSICWNFRP
FT                   LLLLKPDQVASLAPYKKVLLRSQKRRLGMAALKVLEAVAALHTMFGGSYTRFSAIIFNS
FT                   FEPAILLLNLCSHADFPFDQDDNSTSLVGTKVRMTYRIAMQAVEQAIHRLQMLADLSDM
FT                   AASGARVATLLFARSVQPKQSSSPPALTLSVSGSLGPSQFPTPIERYGEQENWPSLEAG
FT                   DPYSMPDNFPSMAQDSFPSPQLSSLKFPVVWGEAFF"
     MQGQKRRVRT CHSCYTRKQK ASESDSICDR QYPCNHCTRR RRPEECVYGP PPVKVPSCPP        60
     VPADQSETQP RPVESARPTR ETPVDDSEAH WSREHSALAR SFGYFEDSNS NTMALLRRLE       120
     LPDQSDTELK NAWPSTWETI HHELDLMPER QIIDFLVQYF VYELNWMKQV IHVPSFLANY       180
     QLWWAKDKIV EIADVEFAAL IARICSYATQ FLPSPSHTVD QIRGRSLADI RDTCSNIGNK       240
     LATACETLDW KGTLVRVQHI IFAALKVSCE GRTSQFWEGI GSACRAAQKA GIHTDTTGLE       300
     SQLAKDSAQE LERDVQRRTF CSLYVLDSHL SRQLDRIPFL SNHLIEETLP RLRLIPDIGN       360
     IPTETATRAP DIFTERLMQV QLGLFWRGLG LQRTCEFDPT ESERIYEKFN SEYLNNLHPA       420
     FAIAHPDTTL DKALPKLPMQ RQLLYIAIFD SICWNFRPLL LLKPDQVASL APYKKVLLRS       480
     QKRRLGMAAL KVLEAVAALH TMFGGSYTRF SAIIFNSFEP AILLLNLCSH ADFPFDQDDN       540
     STSLVGTKVR MTYRIAMQAV EQAIHRLQML ADLSDMAASG ARVATLLFAR SVQPKQSSSP       600
     PALTLSVSGS LGPSQFPTPI ERYGEQENWP SLEAGDPYSM PDNFPSMAQD SFPSPQLSSL       660
     KFPVVWGEAF F                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page