(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE489

PENCW_13.PE489       Location/Qualifiers
FT   CDS             join(1147269..1147320,1147372..1148218,1148278..1148839,
FT                   1148960..1154893)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948795"
FT                   /orf_name="Pc16g04890"
FT                   /product="Pc16g04890 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93159.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniParc:UPI0001831A4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H999"
FT                   /transl_table=1
FT                   /translation="MTAPWPVKHDPIALVGIGCHMPGGVRDIPALWEFLRKQKDVHREF
FT                   DEPRFSAKGFSHSNPDRPGTAVARSGFLLDEDPRLFDAAFFGITDNEVETMDASQRKLL
FT                   EVTYEAFENAGETWEGVSGSRVGVFVGDISFDNYVSQTRDWDYGGKYSATGAFPNMLAN
FT                   RIHYVFNLKGPSLLVNSACTSAMYALHLAMNSIRNGDCESAIVAGSNWIMDPNCHIAMG
FT                   KLGALSATSRSHTFDASADGYARGEGFAALYLKKTSLAIEDGSPIRALIMGSAINANGR
FT                   TNGITNPSGPAQEIVIREAYKNAGNLDPSQTTFLECHGTGTRVGDPTEIKAAGNVFGPS
FT                   RAFEQNDQLVVGSVKTNLGHLEGACALPGILKVVAALEQGEIPPTLGFQTPNPRIDFKQ
FT                   AKARVSTQVEPWPKDKLKRASVTSAGFGGTNGHCIIDHVHNLLPSYVKPGIVGQRVEQL
FT                   NGQNGINGTNGTNGTNGTNGTNGTNGTNGHHNPKTEAPKLVRKADAGTRKLVVFPFSAH
FT                   NQTSLVANVDSLNEVIHQHSLADVAYTLSARRSRFMHRTYCIADKDQVPETGLKQENKL
FT                   EIVSSPQRVSAGFIFTGQGAQWHAMGAGLLQYSVFQNVILYLDSVLSILPEPPSWRIAD
FT                   FIVGNCDTDSIQIPAVSQTVCTAVQIGLVDLLASWSVRPAGVAGHSSGEIAAAYASGRI
FT                   TAAEAIVAAYYRGYMVSFNNQRGAMLAVGFGPEKAMEYIREAGLEERLKVAAINSFDSV
FT                   TISGDADSVEDLSARLSKESVFNRLLRTGGLAYHSHHMLPFGSAYEEKVNDGLRHIKSL
FT                   GVDTTSAKYPFIPWTSSVIPDKSTTEVTASYWRANLESPVRFTDAVSNLLSLPGLNIGA
FT                   LIEIGPHPALKGPLGQTMKSLGKVIPHIASLKRNEDAQRLMLDCAGTLFALNVPVNLVA
FT                   VNAIDGQGPKGEHHLEYGCTAIDLPRYKYTYGPIKYHESRLSKEYRLRPTPRHDLLGSK
FT                   VPGTTKLRPQWRNMLRLKDLGWLNDHRVPPHVLHPGAAHIVMAMVAAEHKYNEFPDALP
FT                   IIGLTMRNVSIKKTLVVPEDDHGVEIVLSMELEDGATAKSPGWASFSIASVVRDSDQWT
FT                   EHCSGQIKIEVSTFEQATPISTTMDGRLVDAQTWYTRFADMGLQFGPSFQGYSDIRADP
FT                   AKNIASARLALNTTAGMFPGGESTYPIHPASLDLVIRLGLMACNGGQAETASVQLPIHF
FT                   NQMKFNYGHLEGRDWATGVSRGELRGLRGAYAQLQMLDEEGKVMLDIDNMRFTSLNNEQ
FT                   ESTSTGDRACKAYSSPFARLVWRPDIRTLSKDQFNEALKCCQENVGEFPQLCKIFDLAG
FT                   HANPDLRVLELGASSNAGAGKAVLKTLVGSNNIKRYREYVATDTTEERLESVRESTAEF
FT                   RDVKYSVLDINEVPSEQGFQSGLYDIIICSDGPQTLQAMQHLRKLVTPAGRLVQVSRTG
FT                   REITSESLRNVDFELVGEVTEPAHHSTITVHALRVTERHQIHSNRLVHLLHGDQGAPEL
FT                   LHRLAQVLGDLGIAIKVSSLDDTQSVVAPNSHVVAFLDGDNLLFAASQHRIGLFQHLAA
FT                   NTASMMWLTSCGLVKGRNPDGSFVSGLLRTLAAENPAGQFLSVDIDAKDFRVQDTEMDT
FT                   LVRSLVDVVLSLQQTSEDSHDIVVNHDLAWQDGNMWVSRLVPDAELQGYDQTTMDDQNM
FT                   KAVPLSTLGPVRAAFRTPGILTSLYFKPYTELWETLPHDWIEIKLEAVGLNWKDLGLCS
FT                   GRFDQNNLSNEYVGVVSDMGSSVHDLSIGDRVYGMGKGHFGNYTRVPAVLAQKLEAGVD
FT                   SLEAATMPLVYMTAVYAFEHITRVRKGSKVLIQSASGGLGLAATQLALSKGADVYVTVG
FT                   TADKAQFLSDVMGISSDHIFSSRRLTDVPRMISATKNGGFDVILSTSQGDMLYESIKAL
FT                   APLGHLIDVGRMDVTSAKTVALELFHKSASFTSFDLGLVIERDVELGGDLMFAVNQHFR
FT                   AGRIGPIRPYHVSDISQLDQALLKLSKGTHIGKMVISYQNPSSLLSVHQSVTHARFLQE
FT                   ANYILVGGMSPLGRCIIRWMVSRGAQHLSVWSRRGGNNLSPEAAALIDEMTSQGVRIQL
FT                   VTCDVSNREQVLRSMQEANSERAVRGVFNYAVSYQDISFDKMTADMFCQGMAAKVFGTK
FT                   NLHEATANLPLDFFTMTSSLGTVYAFPTQSTYLAANNFLDYFARYRRQSGLPATTVSLG
FT                   FINDLGALTQDEVTVNLFARTKGQTVTGSQVLRALEPAFVKHLNTKDQWLGRWEDPLSA
FT                   ANIFTGIDPAVLANMKRAEGKGSASGTVPRWYHDPRVSLMLRAMDDAWRHGNGEDSDKA
FT                   TFGFDDADQSPAVQLRRHFEASIKKTRNGQDKEEVAETVTFVTDAIRTTVAGMLFIDPS
FT                   VVKENHTVVDHGIDSLLAAEFRTWLNSSFGKNISMLKLMDARSSIGSIAQVIVEEAIGA
FT                   "
     MTAPWPVKHD PIALVGIGCH MPGGVRDIPA LWEFLRKQKD VHREFDEPRF SAKGFSHSNP        60
     DRPGTAVARS GFLLDEDPRL FDAAFFGITD NEVETMDASQ RKLLEVTYEA FENAGETWEG       120
     VSGSRVGVFV GDISFDNYVS QTRDWDYGGK YSATGAFPNM LANRIHYVFN LKGPSLLVNS       180
     ACTSAMYALH LAMNSIRNGD CESAIVAGSN WIMDPNCHIA MGKLGALSAT SRSHTFDASA       240
     DGYARGEGFA ALYLKKTSLA IEDGSPIRAL IMGSAINANG RTNGITNPSG PAQEIVIREA       300
     YKNAGNLDPS QTTFLECHGT GTRVGDPTEI KAAGNVFGPS RAFEQNDQLV VGSVKTNLGH       360
     LEGACALPGI LKVVAALEQG EIPPTLGFQT PNPRIDFKQA KARVSTQVEP WPKDKLKRAS       420
     VTSAGFGGTN GHCIIDHVHN LLPSYVKPGI VGQRVEQLNG QNGINGTNGT NGTNGTNGTN       480
     GTNGTNGHHN PKTEAPKLVR KADAGTRKLV VFPFSAHNQT SLVANVDSLN EVIHQHSLAD       540
     VAYTLSARRS RFMHRTYCIA DKDQVPETGL KQENKLEIVS SPQRVSAGFI FTGQGAQWHA       600
     MGAGLLQYSV FQNVILYLDS VLSILPEPPS WRIADFIVGN CDTDSIQIPA VSQTVCTAVQ       660
     IGLVDLLASW SVRPAGVAGH SSGEIAAAYA SGRITAAEAI VAAYYRGYMV SFNNQRGAML       720
     AVGFGPEKAM EYIREAGLEE RLKVAAINSF DSVTISGDAD SVEDLSARLS KESVFNRLLR       780
     TGGLAYHSHH MLPFGSAYEE KVNDGLRHIK SLGVDTTSAK YPFIPWTSSV IPDKSTTEVT       840
     ASYWRANLES PVRFTDAVSN LLSLPGLNIG ALIEIGPHPA LKGPLGQTMK SLGKVIPHIA       900
     SLKRNEDAQR LMLDCAGTLF ALNVPVNLVA VNAIDGQGPK GEHHLEYGCT AIDLPRYKYT       960
     YGPIKYHESR LSKEYRLRPT PRHDLLGSKV PGTTKLRPQW RNMLRLKDLG WLNDHRVPPH      1020
     VLHPGAAHIV MAMVAAEHKY NEFPDALPII GLTMRNVSIK KTLVVPEDDH GVEIVLSMEL      1080
     EDGATAKSPG WASFSIASVV RDSDQWTEHC SGQIKIEVST FEQATPISTT MDGRLVDAQT      1140
     WYTRFADMGL QFGPSFQGYS DIRADPAKNI ASARLALNTT AGMFPGGEST YPIHPASLDL      1200
     VIRLGLMACN GGQAETASVQ LPIHFNQMKF NYGHLEGRDW ATGVSRGELR GLRGAYAQLQ      1260
     MLDEEGKVML DIDNMRFTSL NNEQESTSTG DRACKAYSSP FARLVWRPDI RTLSKDQFNE      1320
     ALKCCQENVG EFPQLCKIFD LAGHANPDLR VLELGASSNA GAGKAVLKTL VGSNNIKRYR      1380
     EYVATDTTEE RLESVRESTA EFRDVKYSVL DINEVPSEQG FQSGLYDIII CSDGPQTLQA      1440
     MQHLRKLVTP AGRLVQVSRT GREITSESLR NVDFELVGEV TEPAHHSTIT VHALRVTERH      1500
     QIHSNRLVHL LHGDQGAPEL LHRLAQVLGD LGIAIKVSSL DDTQSVVAPN SHVVAFLDGD      1560
     NLLFAASQHR IGLFQHLAAN TASMMWLTSC GLVKGRNPDG SFVSGLLRTL AAENPAGQFL      1620
     SVDIDAKDFR VQDTEMDTLV RSLVDVVLSL QQTSEDSHDI VVNHDLAWQD GNMWVSRLVP      1680
     DAELQGYDQT TMDDQNMKAV PLSTLGPVRA AFRTPGILTS LYFKPYTELW ETLPHDWIEI      1740
     KLEAVGLNWK DLGLCSGRFD QNNLSNEYVG VVSDMGSSVH DLSIGDRVYG MGKGHFGNYT      1800
     RVPAVLAQKL EAGVDSLEAA TMPLVYMTAV YAFEHITRVR KGSKVLIQSA SGGLGLAATQ      1860
     LALSKGADVY VTVGTADKAQ FLSDVMGISS DHIFSSRRLT DVPRMISATK NGGFDVILST      1920
     SQGDMLYESI KALAPLGHLI DVGRMDVTSA KTVALELFHK SASFTSFDLG LVIERDVELG      1980
     GDLMFAVNQH FRAGRIGPIR PYHVSDISQL DQALLKLSKG THIGKMVISY QNPSSLLSVH      2040
     QSVTHARFLQ EANYILVGGM SPLGRCIIRW MVSRGAQHLS VWSRRGGNNL SPEAAALIDE      2100
     MTSQGVRIQL VTCDVSNREQ VLRSMQEANS ERAVRGVFNY AVSYQDISFD KMTADMFCQG      2160
     MAAKVFGTKN LHEATANLPL DFFTMTSSLG TVYAFPTQST YLAANNFLDY FARYRRQSGL      2220
     PATTVSLGFI NDLGALTQDE VTVNLFARTK GQTVTGSQVL RALEPAFVKH LNTKDQWLGR      2280
     WEDPLSAANI FTGIDPAVLA NMKRAEGKGS ASGTVPRWYH DPRVSLMLRA MDDAWRHGNG      2340
     EDSDKATFGF DDADQSPAVQ LRRHFEASIK KTRNGQDKEE VAETVTFVTD AIRTTVAGML      2400
     FIDPSVVKEN HTVVDHGIDS LLAAEFRTWL NSSFGKNISM LKLMDARSSI GSIAQVIVEE      2460
     AIGA                                                                   2464
//

If you have problems or comments...

PBIL Back to PBIL home page