(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE490

PENCW_13.PE490       Location/Qualifiers
FT   CDS             1156930..1157784
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217158" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948796"
FT                   /orf_name="Pc16g04900"
FT                   /product="Pc16g04900 protein"
FT                   /protein_id="CAP93160.1"
FT                   /db_xref="UniParc:UPI0001831A4F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A0"
FT                   /transl_table=1
FT                   /translation="MSSNIKSELDTEASSSSFLGDLGPPIRRYPYKGTKQFLETVKMEL
FT                   SRQEEEFEASEWVLFTKVNEQAFSRDFLNSDDNILQRCWNSYDSSQHLLLVKMTVSRAH
FT                   EIAARVFERLFFDCLKPMDLDDCLQTFGSATCKAENGSAKQPDCQFLPRRLPRARTKKW
FT                   PSVVVETGFSESPSKLTSDARFWLSESNGDVQMVITVKIGRSSPNIVLESWELVNNRVQ
FT                   RQQVITISKGDNNHVYLRGQPLIISFNKLFLRPPSIPKEINISLDDDILKKIARNVWEE
FT                   QGF"
     MSSNIKSELD TEASSSSFLG DLGPPIRRYP YKGTKQFLET VKMELSRQEE EFEASEWVLF        60
     TKVNEQAFSR DFLNSDDNIL QRCWNSYDSS QHLLLVKMTV SRAHEIAARV FERLFFDCLK       120
     PMDLDDCLQT FGSATCKAEN GSAKQPDCQF LPRRLPRART KKWPSVVVET GFSESPSKLT       180
     SDARFWLSES NGDVQMVITV KIGRSSPNIV LESWELVNNR VQRQQVITIS KGDNNHVYLR       240
     GQPLIISFNK LFLRPPSIPK EINISLDDDI LKKIARNVWE EQGF                        284
//

If you have problems or comments...

PBIL Back to PBIL home page