(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE491

PENCW_13.PE491       Location/Qualifiers
FT   CDS             1158871..1160532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169919" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948797"
FT                   /orf_name="Pc16g04910"
FT                   /product="Pc16g04910 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93161.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831A50"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A1"
FT                   /transl_table=1
FT                   /translation="MTAISSTPASDSENQNVSQASEDYLHQPNEKDHSSDPGASDDVRK
FT                   ITGYRWFLICAALYLSALMYGLDTTIAADVQGAVIQRFGQVDQLAWIGAGFPLGSVAVI
FT                   LPYGFLFTTFNMKWLYIAGIVLFQGGSALCGGAPNMGALIVGRVIAGAGGTGIYLGGLN
FT                   HFSAMTTRNERGAYLAGTGFVWGLGAILGPVVGGGFSDSSATWRWGFYINLIIGAITAP
FT                   VYLFYLPAIHPAPGRPLKDRLLSLDYVGFVLSAAMWATFAMGFIFAGGIWQWNDGRTIA
FT                   MLVVWGVMLALYALQQTFCIFTTPEHRSFPGHLLRSRTQILFYVTTTCANTCMFFTTFY
FT                   IPIYFQFTRNDSSLMAAVRLLPYLLFTIAFNLASGAALPKIKYYMPMCLVSGIFMTIAG
FT                   ALFVGYLSPSTPTGQIYGFSILMGVGTGITMQLGYSVGSLKVKPTDALSAINLQNVAQI
FT                   GATVICLVIASQAFQSNAIRNLDHVLAGQGFSQSEIQSAVAGSQSTLFEQLSGDLRTAA
FT                   IEAITSAMARAFIIPLVAGALGLVCSLLMSRERLFG"
     MTAISSTPAS DSENQNVSQA SEDYLHQPNE KDHSSDPGAS DDVRKITGYR WFLICAALYL        60
     SALMYGLDTT IAADVQGAVI QRFGQVDQLA WIGAGFPLGS VAVILPYGFL FTTFNMKWLY       120
     IAGIVLFQGG SALCGGAPNM GALIVGRVIA GAGGTGIYLG GLNHFSAMTT RNERGAYLAG       180
     TGFVWGLGAI LGPVVGGGFS DSSATWRWGF YINLIIGAIT APVYLFYLPA IHPAPGRPLK       240
     DRLLSLDYVG FVLSAAMWAT FAMGFIFAGG IWQWNDGRTI AMLVVWGVML ALYALQQTFC       300
     IFTTPEHRSF PGHLLRSRTQ ILFYVTTTCA NTCMFFTTFY IPIYFQFTRN DSSLMAAVRL       360
     LPYLLFTIAF NLASGAALPK IKYYMPMCLV SGIFMTIAGA LFVGYLSPST PTGQIYGFSI       420
     LMGVGTGITM QLGYSVGSLK VKPTDALSAI NLQNVAQIGA TVICLVIASQ AFQSNAIRNL       480
     DHVLAGQGFS QSEIQSAVAG SQSTLFEQLS GDLRTAAIEA ITSAMARAFI IPLVAGALGL       540
     VCSLLMSRER LFG                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page