(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE492

PENCW_13.PE492       Location/Qualifiers
FT   CDS             join(complement(1161392..1161989),
FT                   complement(1161161..1161333))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948798"
FT                   /orf_name="Pc16g04920"
FT                   /product="Pc16g04920 protein"
FT                   /protein_id="CAP93162.1"
FT                   /db_xref="UniParc:UPI0001831A51"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A2"
FT                   /transl_table=1
FT                   /translation="MTFTIANPVLSNPVPTTKSLPNKGKDQEVPSLTRLLHHSHVTTEF
FT                   DPLIFAAAASLQLQLQPEKQYPDTETDTRLIASPYNSVPHLLDIAALERQDRLFALALA
FT                   YLKPIRDDYATAEYTESFNWTEVFDLLRAFSQAEDHTWRSQSYYVVIFRSTLLPGIDSD
FT                   RLYELDAHSHQEAIASGGLLKYWFGAKNDRLQNMATCIWRNRNDARLGGRGPWHAQARA
FT                   AATTMYEQIRFTTLRLVIEDGVQSWKLSDWKEDV"
     MTFTIANPVL SNPVPTTKSL PNKGKDQEVP SLTRLLHHSH VTTEFDPLIF AAAASLQLQL        60
     QPEKQYPDTE TDTRLIASPY NSVPHLLDIA ALERQDRLFA LALAYLKPIR DDYATAEYTE       120
     SFNWTEVFDL LRAFSQAEDH TWRSQSYYVV IFRSTLLPGI DSDRLYELDA HSHQEAIASG       180
     GLLKYWFGAK NDRLQNMATC IWRNRNDARL GGRGPWHAQA RAAATTMYEQ IRFTTLRLVI       240
     EDGVQSWKLS DWKEDV                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page