(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE493

PENCW_13.PE493       Location/Qualifiers
FT   CDS             complement(1162730..1164289)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948799"
FT                   /orf_name="Pc16g04930"
FT                   /product="Pc16g04930 protein"
FT                   /protein_id="CAP93163.1"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR019175"
FT                   /db_xref="UniParc:UPI0001831A52"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A3"
FT                   /transl_table=1
FT                   /translation="MSTAEELLRDFEDDEEDFDVGEGEEVEEEPEQQEDLKEGPDVSND
FT                   FDRSISTADELTRLHKVLRDHYSIRFPELERLVTTPIKYAKTVAVIQNGPFSDIKALST
FT                   SSENMVGVPLKSVLDGPSLMAVAMEATITKGREMTESELKVVLDTCERILKLDNERAAL
FT                   TASIQSRMNQIAPNLAALIGAETAAQFLNQTGGLLELAKIPACNLGAQGSRRSEGLGFA
FT                   TNHGVRAQGFLYDSPLLQEVPMDLRKQGIRIVAAKMVLATRADVSNFAKDGSLGEELKQ
FT                   QCYTRLEKLTETAPNAGTKALPAPDDKPSRKRGGWRARKAKEAVAMTELRKAQNRLAFG
FT                   KEESEVGYGTGSGTVGLGMLGQQDDGRIRATQIDQRTRARLSKNNKGWGTNTPASGTAS
FT                   SLRGFGQGGTSGTASVLQARGIRASGVGSSLPGAAGTSSTIAFTPVQGLELVDPKVQAE
FT                   LKRKRAAEENRWFKSGTFTQAPHQTPVNPQGGENGGFKVPAIPLKRKADTGEGKMGPPP
FT                   KR"
     MSTAEELLRD FEDDEEDFDV GEGEEVEEEP EQQEDLKEGP DVSNDFDRSI STADELTRLH        60
     KVLRDHYSIR FPELERLVTT PIKYAKTVAV IQNGPFSDIK ALSTSSENMV GVPLKSVLDG       120
     PSLMAVAMEA TITKGREMTE SELKVVLDTC ERILKLDNER AALTASIQSR MNQIAPNLAA       180
     LIGAETAAQF LNQTGGLLEL AKIPACNLGA QGSRRSEGLG FATNHGVRAQ GFLYDSPLLQ       240
     EVPMDLRKQG IRIVAAKMVL ATRADVSNFA KDGSLGEELK QQCYTRLEKL TETAPNAGTK       300
     ALPAPDDKPS RKRGGWRARK AKEAVAMTEL RKAQNRLAFG KEESEVGYGT GSGTVGLGML       360
     GQQDDGRIRA TQIDQRTRAR LSKNNKGWGT NTPASGTASS LRGFGQGGTS GTASVLQARG       420
     IRASGVGSSL PGAAGTSSTI AFTPVQGLEL VDPKVQAELK RKRAAEENRW FKSGTFTQAP       480
     HQTPVNPQGG ENGGFKVPAI PLKRKADTGE GKMGPPPKR                              519
//

If you have problems or comments...

PBIL Back to PBIL home page