(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE495

PENCW_13.PE495       Location/Qualifiers
FT   CDS             join(complement(1167905..1167975),
FT                   complement(1166830..1167496))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948801"
FT                   /orf_name="Pc16g04950"
FT                   /product="Putative uncharacterized protein Pc16g04950 "
FT                   /protein_id="CAP93165.1"
FT                   /db_xref="UniParc:UPI0001831A54"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A5"
FT                   /transl_table=1
FT                   /translation="MGRYPETRVSMHDLINKGKPTLEAKKIDLGCEGLGHAAWGCGAVD
FT                   MFLRRGNCLSPPCFEVIRGLIDMFKSCRHIYSHVMIYSVSCSSRNAYKWMCGYHFLFSS
FT                   RKALAQSLIQPTHYTTTDMYYKASPAPLKDYRRGCSDCTTGLGEYVIVTGVWPACTTSI
FT                   VHTCRGQSHSEGTTYQFVPLSRRDRFNCMRVHGLVSLSHADIEMVFWSDYYCMKSPRPR
FT                   VCMDVFMMGTIQGVKAVANMGIT"
     MGRYPETRVS MHDLINKGKP TLEAKKIDLG CEGLGHAAWG CGAVDMFLRR GNCLSPPCFE        60
     VIRGLIDMFK SCRHIYSHVM IYSVSCSSRN AYKWMCGYHF LFSSRKALAQ SLIQPTHYTT       120
     TDMYYKASPA PLKDYRRGCS DCTTGLGEYV IVTGVWPACT TSIVHTCRGQ SHSEGTTYQF       180
     VPLSRRDRFN CMRVHGLVSL SHADIEMVFW SDYYCMKSPR PRVCMDVFMM GTIQGVKAVA       240
     NMGIT                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page