(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE496

PENCW_13.PE496       Location/Qualifiers
FT   CDS             1170386..1172512
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671911"
FT                   /orf_name="Pc16g04960"
FT                   /product="Pc16g04960 protein"
FT                   /protein_id="CAP93166.1"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI0001831A55"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A6"
FT                   /transl_table=1
FT                   /translation="MTGPKPRTKIEGDCSTIHSNTFYVYSPTGFASIPLKENADWNSLP
FT                   SPEHMVTGPACVQGGAGEDEAFYLVGGTGSDGNSGLQRFSFSTQKWETLLMRSADMKDR
FT                   TGHGAGYIPSTSQILVYAGNTDGSTQISQSTLLISTKAPFDIESGVPQGEPALYEPIIL
FT                   PWSSSEVALIGGSATNTAIFIYQTANKQGWTISEATLPSAIQSNSLCALASDSGTKVLE
FT                   EFNMVASPNSVTSYLLSSKGKVQNPVTAIPSLEKRGLTDSYNDTFAPTASWSDYTLAQG
FT                   DGLVVLASGRSNDSLAIFNQTTNAWVNSTELFLGKGDQHVLKPSTTSLTSSTSTSTSSS
FT                   TSTSTSTAASTTPTSSSPVAAVAGGLTDHGKMILGATLGSILGFGLILLIILFLLRRAK
FT                   KKQQQTAQPGRGGDAKDRLSFQDQGIEPLTEGAYPMARSPVPLAAASTDSLAIMSGTYR
FT                   EKSLKPPANTGYGLSQPKASSPLSTIPSSGAMGASSVYTDDTSRAGDDTGHGNQAADRL
FT                   TDEGWGKYFEDGGATNFQSDRSTASSAYTKSDYRGSGWPMTTLTPLNFGFLDQPKPLGH
FT                   VLSGSPTTENGPSETGSRSLIIPESQSARISSADSISIASDDDRDDSKWQGAGQSSWLG
FT                   RPPSSNYTTSFYQASTQDMPWESSNGSLADKGRQSNARRSSVIIPHDIDELPVQGQQNN
FT                   TNSDMSWLNLKADR"
     MTGPKPRTKI EGDCSTIHSN TFYVYSPTGF ASIPLKENAD WNSLPSPEHM VTGPACVQGG        60
     AGEDEAFYLV GGTGSDGNSG LQRFSFSTQK WETLLMRSAD MKDRTGHGAG YIPSTSQILV       120
     YAGNTDGSTQ ISQSTLLIST KAPFDIESGV PQGEPALYEP IILPWSSSEV ALIGGSATNT       180
     AIFIYQTANK QGWTISEATL PSAIQSNSLC ALASDSGTKV LEEFNMVASP NSVTSYLLSS       240
     KGKVQNPVTA IPSLEKRGLT DSYNDTFAPT ASWSDYTLAQ GDGLVVLASG RSNDSLAIFN       300
     QTTNAWVNST ELFLGKGDQH VLKPSTTSLT SSTSTSTSSS TSTSTSTAAS TTPTSSSPVA       360
     AVAGGLTDHG KMILGATLGS ILGFGLILLI ILFLLRRAKK KQQQTAQPGR GGDAKDRLSF       420
     QDQGIEPLTE GAYPMARSPV PLAAASTDSL AIMSGTYREK SLKPPANTGY GLSQPKASSP       480
     LSTIPSSGAM GASSVYTDDT SRAGDDTGHG NQAADRLTDE GWGKYFEDGG ATNFQSDRST       540
     ASSAYTKSDY RGSGWPMTTL TPLNFGFLDQ PKPLGHVLSG SPTTENGPSE TGSRSLIIPE       600
     SQSARISSAD SISIASDDDR DDSKWQGAGQ SSWLGRPPSS NYTTSFYQAS TQDMPWESSN       660
     GSLADKGRQS NARRSSVIIP HDIDELPVQG QQNNTNSDMS WLNLKADR                    708
//

If you have problems or comments...

PBIL Back to PBIL home page