(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE497

PENCW_13.PE497       Location/Qualifiers
FT   CDS             join(complement(1174959..1175733),
FT                   complement(1173175..1174901))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185420" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948802"
FT                   /orf_name="Pc16g04970"
FT                   /product="Pc16g04970 protein"
FT                   /protein_id="CAP93167.1"
FT                   /db_xref="UniParc:UPI0001831A56"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A7"
FT                   /transl_table=1
FT                   /translation="MASSRESQHSLLSEDSIDTRPQRSWNPLNNRLTDSDYRYHSPSDS
FT                   TWSEEVLRDVGLGISNTSGDGIPAEIPTDKRHSTDSTATTTPNTYKIPHSPQTPQTPHT
FT                   HAHVRCPNRATVLQKRLSWVPLTVLILAVYATIFSGIYLGIALRKPRWQTVSSDGPLVP
FT                   STAALLSAFFAKTIELAYVTICVAFLGQVLSRRALMRDSRGISISDMNMRAWIMQPGSM
FT                   IVHWEALRYSALTFLGSIALVSTFVAMLYTTAAQALVAPKLSPGPVEPTILQGKVLSSF
FT                   ANTHYTAANCETPVTNEIDPDYRNTTCIQIEHVGHAYHNYQQWISQWSQLITHNNETSS
FT                   QLQKRPKPTGSLWDNTTVTGSWIDMQDMSTLSKEHGRMINNITMAMPHGGIPGAAMNSK
FT                   NKLKQPTDSSGEGKYTIEASVPSPAVNVLCTGMTKDELSPLVYSSWPGGDKFNMTTWTT
FT                   SPPDDIPDPASWLNRTVVDTLFQFGPKSDQIPPIFGKYPLPYNTILNTTGPWPANAIYL
FT                   LGATPPSNNTNTPEYVMCSLRAKQTGACSTKYSADMSGAFLSTDCENASNGLQYNRRHD
FT                   TPEGQWDADWKNIASEWANALSLNAGISDGAASNARLLMQMMPRYDKGEGAFALDPSLP
FT                   SIAEALAVMAGSTLILSSQNAPFVPFWNYSTENRNVLSEPVYQGFNASIQAFGYASGGT
FT                   EQWQGVFYVILVFAFLTSAVCLGFMIVEARGRQVTDFTEPQNLFALAVNSPQTTQLEGA
FT                   CGCGPWGEQLKERWYIGMEEEDEHYYIRSKTEEKIPLLKTMDSRQLEPMEIDDGGGRML
FT                   SPMVDEFRKVSKRHSFLAKLY"
     MASSRESQHS LLSEDSIDTR PQRSWNPLNN RLTDSDYRYH SPSDSTWSEE VLRDVGLGIS        60
     NTSGDGIPAE IPTDKRHSTD STATTTPNTY KIPHSPQTPQ TPHTHAHVRC PNRATVLQKR       120
     LSWVPLTVLI LAVYATIFSG IYLGIALRKP RWQTVSSDGP LVPSTAALLS AFFAKTIELA       180
     YVTICVAFLG QVLSRRALMR DSRGISISDM NMRAWIMQPG SMIVHWEALR YSALTFLGSI       240
     ALVSTFVAML YTTAAQALVA PKLSPGPVEP TILQGKVLSS FANTHYTAAN CETPVTNEID       300
     PDYRNTTCIQ IEHVGHAYHN YQQWISQWSQ LITHNNETSS QLQKRPKPTG SLWDNTTVTG       360
     SWIDMQDMST LSKEHGRMIN NITMAMPHGG IPGAAMNSKN KLKQPTDSSG EGKYTIEASV       420
     PSPAVNVLCT GMTKDELSPL VYSSWPGGDK FNMTTWTTSP PDDIPDPASW LNRTVVDTLF       480
     QFGPKSDQIP PIFGKYPLPY NTILNTTGPW PANAIYLLGA TPPSNNTNTP EYVMCSLRAK       540
     QTGACSTKYS ADMSGAFLST DCENASNGLQ YNRRHDTPEG QWDADWKNIA SEWANALSLN       600
     AGISDGAASN ARLLMQMMPR YDKGEGAFAL DPSLPSIAEA LAVMAGSTLI LSSQNAPFVP       660
     FWNYSTENRN VLSEPVYQGF NASIQAFGYA SGGTEQWQGV FYVILVFAFL TSAVCLGFMI       720
     VEARGRQVTD FTEPQNLFAL AVNSPQTTQL EGACGCGPWG EQLKERWYIG MEEEDEHYYI       780
     RSKTEEKIPL LKTMDSRQLE PMEIDDGGGR MLSPMVDEFR KVSKRHSFLA KLY              833
//

If you have problems or comments...

PBIL Back to PBIL home page