(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE498

PENCW_13.PE498       Location/Qualifiers
FT   CDS             join(complement(1179721..1180057),
FT                   complement(1178127..1179670))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128964"
FT                   /orf_name="Pc16g04980"
FT                   /product="Pc16g04980 protein"
FT                   /protein_id="CAP93168.1"
FT                   /db_xref="UniParc:UPI0001831B1E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A8"
FT                   /transl_table=1
FT                   /translation="MAYYEDRRYREPRDRYARASYADPYDDPRGRYRRHERDSYVPRAS
FT                   TDSIEEVQRDYPPGSEYAYERPYSSRRPRRPVYENMRRASSVSGYDPYNDASYRSSGPR
FT                   RSRHHEDKRSRRPKYESDSSPSRSPPRHRRRKSFSEQALGALGLGGAASSASRGERGRG
FT                   RSPSRHRHRHRSYSRSPSDSRSPSRHRGGSKRDKSEQRIAQAARAALTAGAVEAFKQRK
FT                   EPGDWAGSKGKRVLTAAVTAGGTDGLVDKDPNKHEKRHVIESTLAGLAASHFVNGSRSQ
FT                   SRGRDGGRSSSGGLKNLAATGALAAAGKEIYDRYSKSRSRPRGRNDSRDSNEERGSHKR
FT                   SKSVSEYISKGMAALGLGEEEGRRDSRDRKEHHREHRPEHRDDRERRHRRGHRRDYSDS
FT                   DSDTDSDYYNRGSRRGKSSRDVGRHHSLDGTNPPPYAPTSASRGESGAHGHGSSSESDS
FT                   DLGDSSDEKKQRKKLKRDMLVTGGLASVATIHAAHSIYGSMEKRKERQKQLKEGEITPE
FT                   EARKHRMKANTKDAVSIGLAALGIKGAYSEWKEVMEKNKENTHFREECAQRAVKRERRR
FT                   ARSQGVPSRHHRWPDEIEYAPSTNDSRSDHGTFYRDGNPYGAHEAPQISY"
     MAYYEDRRYR EPRDRYARAS YADPYDDPRG RYRRHERDSY VPRASTDSIE EVQRDYPPGS        60
     EYAYERPYSS RRPRRPVYEN MRRASSVSGY DPYNDASYRS SGPRRSRHHE DKRSRRPKYE       120
     SDSSPSRSPP RHRRRKSFSE QALGALGLGG AASSASRGER GRGRSPSRHR HRHRSYSRSP       180
     SDSRSPSRHR GGSKRDKSEQ RIAQAARAAL TAGAVEAFKQ RKEPGDWAGS KGKRVLTAAV       240
     TAGGTDGLVD KDPNKHEKRH VIESTLAGLA ASHFVNGSRS QSRGRDGGRS SSGGLKNLAA       300
     TGALAAAGKE IYDRYSKSRS RPRGRNDSRD SNEERGSHKR SKSVSEYISK GMAALGLGEE       360
     EGRRDSRDRK EHHREHRPEH RDDRERRHRR GHRRDYSDSD SDTDSDYYNR GSRRGKSSRD       420
     VGRHHSLDGT NPPPYAPTSA SRGESGAHGH GSSSESDSDL GDSSDEKKQR KKLKRDMLVT       480
     GGLASVATIH AAHSIYGSME KRKERQKQLK EGEITPEEAR KHRMKANTKD AVSIGLAALG       540
     IKGAYSEWKE VMEKNKENTH FREECAQRAV KRERRRARSQ GVPSRHHRWP DEIEYAPSTN       600
     DSRSDHGTFY RDGNPYGAHE APQISY                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page