(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE499

PENCW_13.PE499       Location/Qualifiers
FT   CDS             complement(1181140..1181949)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948803"
FT                   /orf_name="Pc16g04990"
FT                   /product="Pc16g04990 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93169.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831B1F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9A9"
FT                   /transl_table=1
FT                   /translation="MSSCRASIVSILNNDDNPSFAVRSAPRLSRNHTSPSYYPHHSETL
FT                   PPPVSDPQFTRPQASSESPATSPRGTRHPSDAMTEVVQPVSPGSSDGSAYDYITSQPSS
FT                   YHPYTRQDPRREPYRFSARGPAAPRTPPETRSSTSERPSSQTGATRGTGRKNKYPCPYA
FT                   VSHGCSSTFTTSGHAARHGKKHTGEKSVLCPICNKAFTRKDNMKQHIRTHRTHSDEMRS
FT                   TSEPESDARWAMGRLGSAYASASHQLNASQPMEAGVPPVPGAGPQAP"
     MSSCRASIVS ILNNDDNPSF AVRSAPRLSR NHTSPSYYPH HSETLPPPVS DPQFTRPQAS        60
     SESPATSPRG TRHPSDAMTE VVQPVSPGSS DGSAYDYITS QPSSYHPYTR QDPRREPYRF       120
     SARGPAAPRT PPETRSSTSE RPSSQTGATR GTGRKNKYPC PYAVSHGCSS TFTTSGHAAR       180
     HGKKHTGEKS VLCPICNKAF TRKDNMKQHI RTHRTHSDEM RSTSEPESDA RWAMGRLGSA       240
     YASASHQLNA SQPMEAGVPP VPGAGPQAP                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page