(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE500

PENCW_13.PE500       Location/Qualifiers
FT   CDS             join(1184305..1184381,1184533..1184583,1184722..1184911)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948804"
FT                   /orf_name="Pc16g05000"
FT                   /product="Putative uncharacterized protein Pc16g05000 "
FT                   /protein_id="CAP93170.1"
FT                   /db_xref="UniParc:UPI0001831B20"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B0"
FT                   /transl_table=1
FT                   /translation="MRGTADQAKLQSSDPLEPIWERCSTSSDEYASLLVSTKDLVFGAS
FT                   WPAYYDETSEALTTCIASLSPPFLLSGMDTLIYYCTRHIFLAHAAFYMLTCFNPSAEYE
FT                   V"
     MRGTADQAKL QSSDPLEPIW ERCSTSSDEY ASLLVSTKDL VFGASWPAYY DETSEALTTC        60
     IASLSPPFLL SGMDTLIYYC TRHIFLAHAA FYMLTCFNPS AEYEV                       105
//

If you have problems or comments...

PBIL Back to PBIL home page