(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE501

PENCW_13.PE501       Location/Qualifiers
FT   CDS             join(1185347..1185482,1185526..1185652,1186115..1186208,
FT                   1186341..1186534,1186664..1186739,1186828..1187061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128965"
FT                   /orf_name="Pc16g05010"
FT                   /product="Putative uncharacterized protein Pc16g05010 "
FT                   /protein_id="CAP93171.1"
FT                   /db_xref="UniParc:UPI0001831B21"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B1"
FT                   /transl_table=1
FT                   /translation="MGPVPKLLRLSLSGDAQYSVNLRRFAKVETPAYKAEGNDPEWTHY
FT                   DQIIPDNSPRSKNQVPYGLSATPGITLGYRQTLASLVRLDIDRHMWLRQGAVHTWMFER
FT                   GQSITMTPVLLYAVKACCCVHARMPSKREITSNIRRLAPAYSGGEADEIWRLPKDVGSP
FT                   GDFSREIHRAERTSEYVEGGVFWITSTMVGLHIVAKCVDMTIADASNANKMGDLGASRK
FT                   SFGAQSEKYHAPATSTLVSSCPLSLLLSYSLVNEQNPYNGANFFHQGTWYGPQICRGNT
FT                   LVSPC"
     MGPVPKLLRL SLSGDAQYSV NLRRFAKVET PAYKAEGNDP EWTHYDQIIP DNSPRSKNQV        60
     PYGLSATPGI TLGYRQTLAS LVRLDIDRHM WLRQGAVHTW MFERGQSITM TPVLLYAVKA       120
     CCCVHARMPS KREITSNIRR LAPAYSGGEA DEIWRLPKDV GSPGDFSREI HRAERTSEYV       180
     EGGVFWITST MVGLHIVAKC VDMTIADASN ANKMGDLGAS RKSFGAQSEK YHAPATSTLV       240
     SSCPLSLLLS YSLVNEQNPY NGANFFHQGT WYGPQICRGN TLVSPC                      286
//

If you have problems or comments...

PBIL Back to PBIL home page