(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE503

PENCW_13.PE503       Location/Qualifiers
FT   CDS             join(complement(1190086..1190330),
FT                   complement(1189452..1190023),complement(1188868..1189394))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948805"
FT                   /orf_name="Pc16g05030"
FT                   /product="Pc16g05030 protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93173.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniParc:UPI0001831B22"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B2"
FT                   /transl_table=1
FT                   /translation="MDREGKEETEGERLSGTIYLWWHHVMSRDPPNIMPPAAPVKGFRR
FT                   VGIVFARLIVSGEDRGIRPFITWLSDGEHMCDGVTAKLLPRRAASKPVDHAITTFTHVR
FT                   LPKSALLGSLDKPKDMRKEFLSSIWRIRVGSVALPLQMIAGMKRGVFVAGKYSQRRHIF
FT                   GPDQKPKPIISFRTQHGPILHALAQLSVFDAYAQHSIQYFKHPNVAAPVQHAIGAMLKA
FT                   VLYKTSQACLFTLSERCGAQGLFENNHIIEAMLETRAMSIAEGDTLVLSIRLTSEILLN
FT                   RYNMPPAKDPTSLLAKHEQGLLDELRGMTRTISGGHRGEGFDRLVLPRSQEFVEAMGHR
FT                   IAYEAAIEAGVHSDLVALYEIWVILQNQGWFVQHTSLTRERMFQVEADRLSVVLPQLDT
FT                   LLDATGAEPYCSAPIASQASWDHFVDQLETKTGSRTTNIDLLRGGAML"
     MDREGKEETE GERLSGTIYL WWHHVMSRDP PNIMPPAAPV KGFRRVGIVF ARLIVSGEDR        60
     GIRPFITWLS DGEHMCDGVT AKLLPRRAAS KPVDHAITTF THVRLPKSAL LGSLDKPKDM       120
     RKEFLSSIWR IRVGSVALPL QMIAGMKRGV FVAGKYSQRR HIFGPDQKPK PIISFRTQHG       180
     PILHALAQLS VFDAYAQHSI QYFKHPNVAA PVQHAIGAML KAVLYKTSQA CLFTLSERCG       240
     AQGLFENNHI IEAMLETRAM SIAEGDTLVL SIRLTSEILL NRYNMPPAKD PTSLLAKHEQ       300
     GLLDELRGMT RTISGGHRGE GFDRLVLPRS QEFVEAMGHR IAYEAAIEAG VHSDLVALYE       360
     IWVILQNQGW FVQHTSLTRE RMFQVEADRL SVVLPQLDTL LDATGAEPYC SAPIASQASW       420
     DHFVDQLETK TGSRTTNIDL LRGGAML                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page