(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE506

PENCW_13.PE506       Location/Qualifiers
FT   CDS             1198057..1199211
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000050844" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671912"
FT                   /orf_name="Pc16g05060"
FT                   /product="Pc16g05060 protein"
FT                   /function="coenzyme binding"
FT                   /function="hydroxymethylglutaryl-CoA reductase (NADPH)
FT                   activity"
FT                   /biological_process="coenzyme A metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93176.1"
FT                   /db_xref="GO:0004420"
FT                   /db_xref="GO:0015936"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniParc:UPI0001831B23"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B4"
FT                   /transl_table=1
FT                   /translation="MASKTMAKFAHVLQDAKHITERVHDAPEISIENFIGYISVPVGLA
FT                   GPLLIKSPDGTSTRTYAPIATTESAIIASCSRGCKALNESGGGQFHVLSEAMSRSPVFQ
FT                   FNCTEHAIDFARRVPDLWDYIAKTAKSTSRHARLVKLTPNIVGSNVHVRFDYTCGDAAG
FT                   QNTVTIATQRVCDWLLASSQEMELHITGVFIEGNMAPDKKPSWGTVSSPRGVEVVTWAS
FT                   LSDEVCRAVLKCTAENLYHAFRTTQEGGIRNGQFGSNINVANVITGIFIATGQDAASVA
FT                   EGPFGHLTPEYDHKSRQVKLTLYFPSLPVGTVGGGTAYKTQREALGILGCSGSGMKPRL
FT                   AGLIAAFSLALEISTAAAAATNTFTQSHERLARAKQGNNPASKI"
     MASKTMAKFA HVLQDAKHIT ERVHDAPEIS IENFIGYISV PVGLAGPLLI KSPDGTSTRT        60
     YAPIATTESA IIASCSRGCK ALNESGGGQF HVLSEAMSRS PVFQFNCTEH AIDFARRVPD       120
     LWDYIAKTAK STSRHARLVK LTPNIVGSNV HVRFDYTCGD AAGQNTVTIA TQRVCDWLLA       180
     SSQEMELHIT GVFIEGNMAP DKKPSWGTVS SPRGVEVVTW ASLSDEVCRA VLKCTAENLY       240
     HAFRTTQEGG IRNGQFGSNI NVANVITGIF IATGQDAASV AEGPFGHLTP EYDHKSRQVK       300
     LTLYFPSLPV GTVGGGTAYK TQREALGILG CSGSGMKPRL AGLIAAFSLA LEISTAAAAA       360
     TNTFTQSHER LARAKQGNNP ASKI                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page